BLASTX nr result
ID: Mentha23_contig00011987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00011987 (746 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307472.2| hypothetical protein POPTR_0005s20850g [Popu... 82 2e-13 emb|CAG27628.1| hypothetical protein [Populus deltoides x Populu... 82 2e-13 ref|XP_002309917.1| hypothetical protein POPTR_0007s04191g [Popu... 82 2e-13 ref|XP_002262838.1| PREDICTED: uncharacterized protein LOC100255... 82 3e-13 ref|XP_004498373.1| PREDICTED: uncharacterized protein LOC101496... 81 4e-13 ref|XP_007200390.1| hypothetical protein PRUPE_ppa008434mg [Prun... 81 4e-13 ref|XP_002267135.1| PREDICTED: uncharacterized protein LOC100243... 81 4e-13 gb|EXB37648.1| hypothetical protein L484_021855 [Morus notabilis] 80 6e-13 ref|XP_002520252.1| conserved hypothetical protein [Ricinus comm... 80 6e-13 ref|XP_007019305.1| Uncharacterized protein TCM_035327 [Theobrom... 80 1e-12 ref|XP_007048406.1| Uncharacterized protein TCM_001500 [Theobrom... 79 1e-12 ref|XP_006434342.1| hypothetical protein CICLE_v10001753mg [Citr... 79 2e-12 ref|XP_002526640.1| conserved hypothetical protein [Ricinus comm... 78 4e-12 gb|AEX10892.1| hypothetical protein 0_1077_01 [Pinus radiata] 77 5e-12 gb|AEX10882.1| hypothetical protein 0_1077_01 [Pinus taeda] 77 5e-12 gb|AEX10879.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|3... 77 5e-12 gb|EXC49700.1| hypothetical protein L484_000477 [Morus notabilis] 77 6e-12 ref|XP_004237719.1| PREDICTED: uncharacterized protein LOC101258... 77 8e-12 ref|XP_003526666.1| PREDICTED: uncharacterized protein LOC100798... 76 1e-11 ref|XP_003573268.1| PREDICTED: uncharacterized protein LOC100828... 76 1e-11 >ref|XP_002307472.2| hypothetical protein POPTR_0005s20850g [Populus trichocarpa] gi|550339417|gb|EEE94468.2| hypothetical protein POPTR_0005s20850g [Populus trichocarpa] Length = 331 Score = 82.0 bits (201), Expect = 2e-13 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDFD 135 TV+YFVCKSYHHENIDKS LS+HLEVYLG+Y+PL +K+VQ+E FD Sbjct: 286 TVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQFD 330 >emb|CAG27628.1| hypothetical protein [Populus deltoides x Populus maximowiczii] Length = 138 Score = 82.0 bits (201), Expect = 2e-13 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDFD 135 TV+YFVCKSYHHENIDKS LS+HLEVYLG+Y+PL +K+VQ+E FD Sbjct: 93 TVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQFD 137 >ref|XP_002309917.1| hypothetical protein POPTR_0007s04191g [Populus trichocarpa] gi|222852820|gb|EEE90367.1| hypothetical protein POPTR_0007s04191g [Populus trichocarpa] Length = 334 Score = 82.0 bits (201), Expect = 2e-13 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDFD 135 TVLYFVCKSYHHENIDKS LS+HLEVYLG+Y+PL +K+VQME F+ Sbjct: 289 TVLYFVCKSYHHENIDKSSLSDHLEVYLGEYIPLKSKDVQMEQFE 333 >ref|XP_002262838.1| PREDICTED: uncharacterized protein LOC100255146 [Vitis vinifera] Length = 332 Score = 81.6 bits (200), Expect = 3e-13 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDFD 135 TV+YFVCKSYHHENIDKS LS+HLEVYLG+Y+PL +K+VQ+E FD Sbjct: 287 TVIYFVCKSYHHENIDKSSLSDHLEVYLGEYVPLKSKDVQLEQFD 331 >ref|XP_004498373.1| PREDICTED: uncharacterized protein LOC101496539 [Cicer arietinum] Length = 333 Score = 80.9 bits (198), Expect = 4e-13 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDF 132 TVLYFVCKSYHHENIDKS L++HLEVYLG+Y+PL AK+VQME++ Sbjct: 288 TVLYFVCKSYHHENIDKSALADHLEVYLGEYVPLTAKDVQMENY 331 >ref|XP_007200390.1| hypothetical protein PRUPE_ppa008434mg [Prunus persica] gi|462395790|gb|EMJ01589.1| hypothetical protein PRUPE_ppa008434mg [Prunus persica] Length = 332 Score = 80.9 bits (198), Expect = 4e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQME 126 TVLYFVCKSYHHENIDKS LS+HLEVYLGDY+PL AK+VQ+E Sbjct: 287 TVLYFVCKSYHHENIDKSALSDHLEVYLGDYVPLTAKDVQLE 328 >ref|XP_002267135.1| PREDICTED: uncharacterized protein LOC100243726 [Vitis vinifera] Length = 332 Score = 80.9 bits (198), Expect = 4e-13 Identities = 33/45 (73%), Positives = 42/45 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDFD 135 T++YFVCKSYHHENIDKS LS+HLEVY+G+Y+PL AK+VQ+E +D Sbjct: 287 TIIYFVCKSYHHENIDKSALSDHLEVYMGEYVPLKAKDVQLEQYD 331 >gb|EXB37648.1| hypothetical protein L484_021855 [Morus notabilis] Length = 327 Score = 80.5 bits (197), Expect = 6e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDF 132 TVLYFVCKSYHHENIDKS LS+HLEVYLG+Y+PL AK+VQ+E + Sbjct: 282 TVLYFVCKSYHHENIDKSALSDHLEVYLGEYVPLTAKDVQLEQY 325 >ref|XP_002520252.1| conserved hypothetical protein [Ricinus communis] gi|223540471|gb|EEF42038.1| conserved hypothetical protein [Ricinus communis] Length = 332 Score = 80.5 bits (197), Expect = 6e-13 Identities = 34/45 (75%), Positives = 42/45 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDFD 135 TV+YFVCKSYHHENIDKS LS+HLEVYLG+Y+PL +K+VQ+E F+ Sbjct: 287 TVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQFE 331 >ref|XP_007019305.1| Uncharacterized protein TCM_035327 [Theobroma cacao] gi|508724633|gb|EOY16530.1| Uncharacterized protein TCM_035327 [Theobroma cacao] Length = 332 Score = 79.7 bits (195), Expect = 1e-12 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDF 132 TV+YFVCKSYHHENIDKS LS+HLEVYLG+Y+PL AK+VQ+E + Sbjct: 287 TVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLKAKDVQLEQY 330 >ref|XP_007048406.1| Uncharacterized protein TCM_001500 [Theobroma cacao] gi|508700667|gb|EOX92563.1| Uncharacterized protein TCM_001500 [Theobroma cacao] Length = 346 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDF 132 TV+YFVCKSYHHENIDKS L++HLEVYLG+Y+PL AK+VQ+E F Sbjct: 301 TVIYFVCKSYHHENIDKSSLADHLEVYLGEYVPLKAKDVQLEQF 344 >ref|XP_006434342.1| hypothetical protein CICLE_v10001753mg [Citrus clementina] gi|557536464|gb|ESR47582.1| hypothetical protein CICLE_v10001753mg [Citrus clementina] Length = 338 Score = 78.6 bits (192), Expect = 2e-12 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDFD 135 TV+YFVCKSYHHENIDKS LS+HLEVYLG+Y+PL +K++Q+E ++ Sbjct: 293 TVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLKSKDIQLEHYE 337 >ref|XP_002526640.1| conserved hypothetical protein [Ricinus communis] gi|223534032|gb|EEF35752.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 77.8 bits (190), Expect = 4e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDF 132 TVLYFVCKS+H+ENIDKS+LS+HLE YLGDY+PL A NVQME + Sbjct: 291 TVLYFVCKSHHNENIDKSILSDHLEAYLGDYVPLKAANVQMEQY 334 >gb|AEX10892.1| hypothetical protein 0_1077_01 [Pinus radiata] Length = 129 Score = 77.4 bits (189), Expect = 5e-12 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMED 129 +VLYFVCKSYHHE+IDKS LS+HLE YLGDY+PL++ N+Q+ED Sbjct: 82 SVLYFVCKSYHHESIDKSSLSDHLETYLGDYLPLISSNIQLED 124 >gb|AEX10882.1| hypothetical protein 0_1077_01 [Pinus taeda] Length = 129 Score = 77.4 bits (189), Expect = 5e-12 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMED 129 +VLYFVCKSYHHE+IDKS LS+HLE YLGDY+PL++ N+Q+ED Sbjct: 82 SVLYFVCKSYHHESIDKSSLSDHLEAYLGDYLPLISSNIQLED 124 >gb|AEX10879.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059644|gb|AEX10880.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059646|gb|AEX10881.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059650|gb|AEX10883.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059652|gb|AEX10884.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059654|gb|AEX10885.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059656|gb|AEX10886.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059658|gb|AEX10887.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059660|gb|AEX10888.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059662|gb|AEX10889.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059664|gb|AEX10890.1| hypothetical protein 0_1077_01 [Pinus taeda] gi|367059666|gb|AEX10891.1| hypothetical protein 0_1077_01 [Pinus taeda] Length = 129 Score = 77.4 bits (189), Expect = 5e-12 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMED 129 +VLYFVCKSYHHE+IDKS LS+HLE YLGDY+PL++ N+Q+ED Sbjct: 82 SVLYFVCKSYHHESIDKSSLSDHLEAYLGDYLPLISSNIQLED 124 >gb|EXC49700.1| hypothetical protein L484_000477 [Morus notabilis] Length = 334 Score = 77.0 bits (188), Expect = 6e-12 Identities = 32/41 (78%), Positives = 39/41 (95%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQM 123 T++YF+CKSYHHENIDKS LSEHLEVYLGDY+PL +K+VQ+ Sbjct: 287 TIIYFICKSYHHENIDKSSLSEHLEVYLGDYVPLKSKDVQL 327 >ref|XP_004237719.1| PREDICTED: uncharacterized protein LOC101258062 [Solanum lycopersicum] Length = 344 Score = 76.6 bits (187), Expect = 8e-12 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDF 132 T++YFVCKSYHHENIDKS LS+HLEVYLG+Y PL +++VQME + Sbjct: 299 TIIYFVCKSYHHENIDKSALSDHLEVYLGEYEPLKSQDVQMESY 342 >ref|XP_003526666.1| PREDICTED: uncharacterized protein LOC100798371 [Glycine max] Length = 333 Score = 76.3 bits (186), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMED 129 TVLYFVCKSYHH+NIDKS LS+HLEVY G+Y PL AK+VQME+ Sbjct: 288 TVLYFVCKSYHHQNIDKSALSDHLEVYHGEYEPLKAKDVQMEE 330 >ref|XP_003573268.1| PREDICTED: uncharacterized protein LOC100828305 [Brachypodium distachyon] Length = 337 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +1 Query: 1 TVLYFVCKSYHHENIDKSLLSEHLEVYLGDYMPLMAKNVQMEDFD 135 TV+Y VCKSYHHE+IDKS +S+HLEVYLGDY+PL A +VQME F+ Sbjct: 292 TVVYLVCKSYHHESIDKSNISDHLEVYLGDYVPLKASDVQMEHFE 336