BLASTX nr result
ID: Mentha23_contig00011970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00011970 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40383.1| hypothetical protein MIMGU_mgv1a001106mg [Mimulus... 74 2e-11 gb|EYU17783.1| hypothetical protein MIMGU_mgv1a0218241mg, partia... 58 1e-06 gb|EPS62669.1| hypothetical protein M569_12120, partial [Genlise... 57 2e-06 >gb|EYU40383.1| hypothetical protein MIMGU_mgv1a001106mg [Mimulus guttatus] Length = 888 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/60 (60%), Positives = 46/60 (76%) Frame = +2 Query: 2 ISLISGAETDLKALQDELELMKALLVDSTKTREKGQVFIKLGKQIREAVYEAEDAIDTCL 181 + LISGAE +LK LQ+EL+LMKA LV S REKG++F + QIR+ V+EAED +DTCL Sbjct: 21 VHLISGAEGELKQLQNELDLMKAFLVQSANRREKGELFRQFETQIRDVVHEAEDTLDTCL 80 >gb|EYU17783.1| hypothetical protein MIMGU_mgv1a0218241mg, partial [Mimulus guttatus] Length = 147 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/68 (38%), Positives = 43/68 (63%) Frame = +2 Query: 2 ISLISGAETDLKALQDELELMKALLVDSTKTREKGQVFIKLGKQIREAVYEAEDAIDTCL 181 I LI AE +L L+ +L+ +K+ L D+ KG+VF + +++RE +Y+ ED +DTCL Sbjct: 21 IDLIGNAEDELLGLKSDLDTLKSFLADAAGKPNKGEVFRRAERKMREVIYQVEDTLDTCL 80 Query: 182 TNNNKKGQ 205 T + K + Sbjct: 81 TASAAKAK 88 >gb|EPS62669.1| hypothetical protein M569_12120, partial [Genlisea aurea] Length = 143 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/60 (46%), Positives = 40/60 (66%) Frame = +2 Query: 8 LISGAETDLKALQDELELMKALLVDSTKTREKGQVFIKLGKQIREAVYEAEDAIDTCLTN 187 LISGA +L+ LQ++L+ MK+ L D+ + K + F + KQIRE VY ED ID C++N Sbjct: 23 LISGASWELEQLQNDLQSMKSFLEDNASKKAKSKNFKEWEKQIREVVYRVEDVIDECVSN 82