BLASTX nr result
ID: Mentha23_contig00011790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00011790 (660 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35365.1| hypothetical protein MIMGU_mgv1a017348mg [Mimulus... 71 3e-10 gb|EYU19380.1| hypothetical protein MIMGU_mgv1a020325mg [Mimulus... 68 2e-09 ref|XP_006358523.1| PREDICTED: uncharacterized protein LOC102578... 56 9e-06 >gb|EYU35365.1| hypothetical protein MIMGU_mgv1a017348mg [Mimulus guttatus] Length = 80 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 377 AYKVYPSDEDRGRWVAEPRIDEKASAYISLTTHKW 481 AYKVYPSDEDRGRWVAEP ID+KASAYISLTT KW Sbjct: 39 AYKVYPSDEDRGRWVAEPGIDKKASAYISLTTDKW 73 >gb|EYU19380.1| hypothetical protein MIMGU_mgv1a020325mg [Mimulus guttatus] Length = 84 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 377 AYKVYPSDEDRGRWVAEPRIDEKASAYISLTTHKW 481 AYKVYPSDEDRGRWVAEP ID+KASA+ISLTT +W Sbjct: 42 AYKVYPSDEDRGRWVAEPGIDKKASAFISLTTDRW 76 >ref|XP_006358523.1| PREDICTED: uncharacterized protein LOC102578579 [Solanum tuberosum] Length = 74 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +2 Query: 377 AYKVYPSDEDRGRWVAEPRIDEKASAYISLTTHKWGN 487 AYKV+PSDEDRG+WVA+P ID KA+ +IS T KW + Sbjct: 35 AYKVWPSDEDRGQWVADPGIDNKAALFISNRTAKWSS 71