BLASTX nr result
ID: Mentha23_contig00011555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00011555 (561 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17700.1| hypothetical protein MIMGU_mgv1a001718mg [Mimulus... 56 7e-06 >gb|EYU17700.1| hypothetical protein MIMGU_mgv1a001718mg [Mimulus guttatus] Length = 769 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 561 EKVDDLGDGGADGMEQRHRERGPNHA--KRGGNFYRR*SGPFHV 436 EKV++ DG +GMEQRHRERG + + KRGGNFYRR +GP HV Sbjct: 722 EKVEEAADG-VEGMEQRHRERGQSQSQPKRGGNFYRRQTGPAHV 764