BLASTX nr result
ID: Mentha23_contig00011281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00011281 (658 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633443.1| PREDICTED: ABC transporter G family member 1... 46 1e-06 emb|CBI25312.3| unnamed protein product [Vitis vinifera] 46 1e-06 >ref|XP_003633443.1| PREDICTED: ABC transporter G family member 16-like [Vitis vinifera] Length = 747 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +3 Query: 24 SPTLSHLLKCVDDLQKEATEDEMSVHQAFNFSDVGM 131 SPTL HLLKCV D++KE T DE VHQ + M Sbjct: 38 SPTLGHLLKCVGDVRKEVTGDETPVHQVLEMGEANM 73 Score = 32.7 bits (73), Expect(2) = 1e-06 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +2 Query: 134 EQMPIPFVISFSNITYSINI 193 E +PFV+SFSN+TYS+N+ Sbjct: 74 EPRSLPFVLSFSNLTYSVNV 93 >emb|CBI25312.3| unnamed protein product [Vitis vinifera] Length = 663 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +3 Query: 24 SPTLSHLLKCVDDLQKEATEDEMSVHQAFNFSDVGM 131 SPTL HLLKCV D++KE T DE VHQ + M Sbjct: 38 SPTLGHLLKCVGDVRKEVTGDETPVHQVLEMGEANM 73 Score = 32.7 bits (73), Expect(2) = 1e-06 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +2 Query: 134 EQMPIPFVISFSNITYSINI 193 E +PFV+SFSN+TYS+N+ Sbjct: 74 EPRSLPFVLSFSNLTYSVNV 93