BLASTX nr result
ID: Mentha23_contig00010779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00010779 (508 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27461.1| hypothetical protein MIMGU_mgv1a011482mg [Mimulus... 67 3e-09 ref|XP_004244025.1| PREDICTED: E3 ubiquitin-protein ligase At4g1... 61 1e-07 ref|XP_006346113.1| PREDICTED: E3 ubiquitin-protein ligase At1g6... 60 3e-07 ref|XP_007205484.1| hypothetical protein PRUPE_ppa008150mg [Prun... 57 3e-06 ref|XP_007205483.1| hypothetical protein PRUPE_ppa008150mg [Prun... 57 3e-06 >gb|EYU27461.1| hypothetical protein MIMGU_mgv1a011482mg [Mimulus guttatus] Length = 280 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 385 SGEEKKVWPMRIWVLGYAFGSFLSLILLLWRYRFVYL 495 SG E+ VWPMRIWV GYAFG FLSL+LL WRYR VYL Sbjct: 113 SGGERPVWPMRIWVSGYAFGCFLSLVLLSWRYRLVYL 149 >ref|XP_004244025.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Solanum lycopersicum] Length = 329 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 391 EEKKVWPMRIWVLGYAFGSFLSLILLLWRYRFVYLSQSN 507 +E+ VWPMRIWV GY FG +SLILL WRY +Y+SQ+N Sbjct: 112 DERPVWPMRIWVFGYGFGCVISLILLYWRYWVLYVSQTN 150 >ref|XP_006346113.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum tuberosum] Length = 325 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 391 EEKKVWPMRIWVLGYAFGSFLSLILLLWRYRFVYLSQSN 507 EE+ VWPMRIWV GY FG +SLILL WRY +Y+SQ++ Sbjct: 108 EERPVWPMRIWVFGYGFGCVISLILLYWRYWTLYVSQTD 146 >ref|XP_007205484.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica] gi|462401126|gb|EMJ06683.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica] Length = 343 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 385 SGEEKKVWPMRIWVLGYAFGSFLSLILLLWRYRFVYLSQSN 507 S +E+ VWPMRIW++GY G FL+L++L RYR +YLSQ + Sbjct: 112 SKKERPVWPMRIWIVGYDIGCFLNLLVLFGRYRLLYLSQGD 152 >ref|XP_007205483.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica] gi|462401125|gb|EMJ06682.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica] Length = 330 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 385 SGEEKKVWPMRIWVLGYAFGSFLSLILLLWRYRFVYLSQSN 507 S +E+ VWPMRIW++GY G FL+L++L RYR +YLSQ + Sbjct: 112 SKKERPVWPMRIWIVGYDIGCFLNLLVLFGRYRLLYLSQGD 152