BLASTX nr result
ID: Mentha23_contig00010755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00010755 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42220.1| hypothetical protein MIMGU_mgv1a010004mg [Mimulus... 74 3e-11 gb|EYU42219.1| hypothetical protein MIMGU_mgv1a010004mg [Mimulus... 74 3e-11 gb|EYU46671.1| hypothetical protein MIMGU_mgv1a010669mg [Mimulus... 71 2e-10 ref|XP_006355802.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 70 2e-10 ref|XP_004240541.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 70 2e-10 ref|XP_006359376.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 69 5e-10 ref|XP_004247421.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 69 5e-10 ref|XP_004247420.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 69 5e-10 gb|EPS63380.1| hypothetical protein M569_11405, partial [Genlise... 69 7e-10 emb|CBI36847.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002265998.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 67 2e-09 emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] 67 2e-09 ref|XP_007163110.1| hypothetical protein PHAVU_001G207100g [Phas... 66 4e-09 ref|XP_007163109.1| hypothetical protein PHAVU_001G207100g [Phas... 66 4e-09 ref|XP_006604719.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 66 4e-09 ref|NP_001276294.1| uncharacterized protein LOC100796900 [Glycin... 66 4e-09 gb|EXC10292.1| Pre-mRNA-splicing factor SF2 [Morus notabilis] 66 6e-09 ref|XP_006444331.1| hypothetical protein CICLE_v10021764mg [Citr... 66 6e-09 ref|XP_006444324.1| hypothetical protein CICLE_v10021764mg [Citr... 66 6e-09 ref|XP_006444320.1| hypothetical protein CICLE_v10021764mg [Citr... 66 6e-09 >gb|EYU42220.1| hypothetical protein MIMGU_mgv1a010004mg [Mimulus guttatus] Length = 324 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS Sbjct: 116 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 147 >gb|EYU42219.1| hypothetical protein MIMGU_mgv1a010004mg [Mimulus guttatus] Length = 325 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS Sbjct: 116 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 147 >gb|EYU46671.1| hypothetical protein MIMGU_mgv1a010669mg [Mimulus guttatus] Length = 305 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLP+SASWQDLKDHMRRAGDVCFSQVFHEGS Sbjct: 112 TGLPNSASWQDLKDHMRRAGDVCFSQVFHEGS 143 >ref|XP_006355802.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Solanum tuberosum] Length = 367 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLPHSASWQDLKDHMRRAGDVCFSQVF EGS Sbjct: 123 TGLPHSASWQDLKDHMRRAGDVCFSQVFREGS 154 >ref|XP_004240541.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Solanum lycopersicum] Length = 361 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLPHSASWQDLKDHMRRAGDVCFSQVF EGS Sbjct: 121 TGLPHSASWQDLKDHMRRAGDVCFSQVFREGS 152 >ref|XP_006359376.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Solanum tuberosum] Length = 315 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLPHSASWQDLKDHMRRAGDVCFSQVF +GS Sbjct: 122 TGLPHSASWQDLKDHMRRAGDVCFSQVFRDGS 153 >ref|XP_004247421.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 2 [Solanum lycopersicum] Length = 270 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLPHSASWQDLKDHMRRAGDVCFSQVF +GS Sbjct: 117 TGLPHSASWQDLKDHMRRAGDVCFSQVFRDGS 148 >ref|XP_004247420.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 1 [Solanum lycopersicum] Length = 308 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLPHSASWQDLKDHMRRAGDVCFSQVF +GS Sbjct: 117 TGLPHSASWQDLKDHMRRAGDVCFSQVFRDGS 148 >gb|EPS63380.1| hypothetical protein M569_11405, partial [Genlisea aurea] Length = 278 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLPHSASWQDLKDHMRRAGDVCFS VF+EGS Sbjct: 117 TGLPHSASWQDLKDHMRRAGDVCFSDVFNEGS 148 >emb|CBI36847.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEG 226 TGLP SASWQDLKDHMRRAGDVCFSQVFH+G Sbjct: 116 TGLPSSASWQDLKDHMRRAGDVCFSQVFHDG 146 >ref|XP_002265998.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 1 [Vitis vinifera] gi|359480272|ref|XP_003632425.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 2 [Vitis vinifera] Length = 296 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEG 226 TGLP SASWQDLKDHMRRAGDVCFSQVFH+G Sbjct: 116 TGLPSSASWQDLKDHMRRAGDVCFSQVFHDG 146 >emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] Length = 720 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEG 226 TGLP SASWQDLKDHMRRAGDVCFSQVFH+G Sbjct: 116 TGLPSSASWQDLKDHMRRAGDVCFSQVFHDG 146 >ref|XP_007163110.1| hypothetical protein PHAVU_001G207100g [Phaseolus vulgaris] gi|561036574|gb|ESW35104.1| hypothetical protein PHAVU_001G207100g [Phaseolus vulgaris] Length = 268 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEG 226 TGLP SASWQDLKDHMR+AGDVCFSQVFH+G Sbjct: 116 TGLPSSASWQDLKDHMRKAGDVCFSQVFHDG 146 >ref|XP_007163109.1| hypothetical protein PHAVU_001G207100g [Phaseolus vulgaris] gi|561036573|gb|ESW35103.1| hypothetical protein PHAVU_001G207100g [Phaseolus vulgaris] Length = 299 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEG 226 TGLP SASWQDLKDHMR+AGDVCFSQVFH+G Sbjct: 116 TGLPSSASWQDLKDHMRKAGDVCFSQVFHDG 146 >ref|XP_006604719.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X2 [Glycine max] Length = 309 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEG 226 TGLP SASWQDLKDHMR+AGDVCFSQVFH+G Sbjct: 116 TGLPSSASWQDLKDHMRKAGDVCFSQVFHDG 146 >ref|NP_001276294.1| uncharacterized protein LOC100796900 [Glycine max] gi|255646543|gb|ACU23746.1| unknown [Glycine max] Length = 310 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEG 226 TGLP SASWQDLKDHMR+AGDVCFSQVFH+G Sbjct: 116 TGLPSSASWQDLKDHMRKAGDVCFSQVFHDG 146 >gb|EXC10292.1| Pre-mRNA-splicing factor SF2 [Morus notabilis] Length = 389 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLP SASWQDLKDHMRRAGDVCFSQVF +GS Sbjct: 116 TGLPSSASWQDLKDHMRRAGDVCFSQVFRDGS 147 >ref|XP_006444331.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903720|ref|XP_006444348.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546593|gb|ESR57571.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546610|gb|ESR57588.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] Length = 275 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLP SASWQDLKDHMRRAGDVCFSQVF +GS Sbjct: 114 TGLPSSASWQDLKDHMRRAGDVCFSQVFRDGS 145 >ref|XP_006444324.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903680|ref|XP_006444328.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903682|ref|XP_006444329.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903706|ref|XP_006444341.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903710|ref|XP_006444343.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903712|ref|XP_006444344.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|568852587|ref|XP_006479954.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X2 [Citrus sinensis] gi|557546586|gb|ESR57564.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546590|gb|ESR57568.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546591|gb|ESR57569.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546603|gb|ESR57581.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546605|gb|ESR57583.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546606|gb|ESR57584.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] Length = 270 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLP SASWQDLKDHMRRAGDVCFSQVF +GS Sbjct: 114 TGLPSSASWQDLKDHMRRAGDVCFSQVFRDGS 145 >ref|XP_006444320.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903670|ref|XP_006444323.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|568852581|ref|XP_006479953.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Citrus sinensis] gi|557546582|gb|ESR57560.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546585|gb|ESR57563.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] Length = 299 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 318 TGLPHSASWQDLKDHMRRAGDVCFSQVFHEGS 223 TGLP SASWQDLKDHMRRAGDVCFSQVF +GS Sbjct: 114 TGLPSSASWQDLKDHMRRAGDVCFSQVFRDGS 145