BLASTX nr result
ID: Mentha23_contig00010739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00010739 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527279.1| PREDICTED: probable ADP-ribosylation factor ... 57 3e-06 >ref|XP_003527279.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD5-like [Glycine max] Length = 484 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/62 (50%), Positives = 38/62 (61%) Frame = -1 Query: 367 GNSYAPPTSGPYAMGNNAPSNGSTPSMPVAGKQNAXXXXXXXXXSGKEFDFSSLTQGFFA 188 G+S P S YAMG APSNGSTP+ + Q+A +G ++DFSSLTQG FA Sbjct: 424 GSSVQYPPSSYYAMGQVAPSNGSTPT-EASKPQSASPASSNTSKTGNDYDFSSLTQGMFA 482 Query: 187 KH 182 KH Sbjct: 483 KH 484