BLASTX nr result
ID: Mentha23_contig00009976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00009976 (1248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 70 2e-09 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 69.7 bits (169), Expect = 2e-09 Identities = 60/180 (33%), Positives = 89/180 (49%), Gaps = 6/180 (3%) Frame = -1 Query: 1248 VELYSLKNNSWKEISAPEVRVENCGI---YVNNKCYW--ISYSPFSVISFDFEKESLSSF 1084 VELYSLK++SWKEIS PE + YVN YW S + ++SFD E S+ Sbjct: 193 VELYSLKSDSWKEISVPEAHPYASPLFNNYVNGSYYWQATGNSDYLILSFDMANEKFST- 251 Query: 1083 IPLPKALPTMHSSTDDVDVFDGLRIFEYIGSLAAIGYKKSGLCTLFEAYTLKXXXXXXXX 904 LP LPT S L++ ++ GSL AI Y + G + + + Sbjct: 252 --LP--LPTFGGSLAQY----YLQLLDFNGSLGAIVYPREGTEKSIDLWVMN-------- 295 Query: 903 XXXXQKKFTVK-VFGDHKPLGFGENGRSLFLQGNNAKDKCYQLGVFDLIDQYLEKLPIFA 727 ++F+++ V G +PLGF +NG LFL+ +N ++L +FD + L+ L I A Sbjct: 296 -GSWTRQFSIESVSGVERPLGFWKNG-ELFLESSN-----HELVLFDPATRELKNLGIHA 348