BLASTX nr result
ID: Mentha23_contig00009847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00009847 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22855.1| hypothetical protein MIMGU_mgv1a010065mg [Mimulus... 57 3e-06 >gb|EYU22855.1| hypothetical protein MIMGU_mgv1a010065mg [Mimulus guttatus] Length = 323 Score = 57.0 bits (136), Expect = 3e-06 Identities = 41/86 (47%), Positives = 48/86 (55%), Gaps = 2/86 (2%) Frame = -1 Query: 254 MLIHYS-SPPSQQCESTAIFISSLKPRNKFQCPNSYHFSIVRSNEASLFCLSRKPTK-KF 81 M+I S SPP Q C TAIFI +PRN P S F NE SL SRKPTK KF Sbjct: 1 MIIQCSFSPPLQHCFRTAIFI---RPRNNPHSPISCAF-----NEKSLLFFSRKPTKLKF 52 Query: 80 RIPKLSLPVFGKEARSSSPLTLRKIE 3 +P+ SL V K+ S S TL ++E Sbjct: 53 TVPRFSLQVLKKKNESCSSSTLTEVE 78