BLASTX nr result
ID: Mentha23_contig00009751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00009751 (493 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27768.1| hypothetical protein MIMGU_mgv1a011558mg [Mimulus... 63 1e-14 >gb|EYU27768.1| hypothetical protein MIMGU_mgv1a011558mg [Mimulus guttatus] Length = 277 Score = 62.8 bits (151), Expect(2) = 1e-14 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 15/78 (19%) Frame = -1 Query: 250 HITGAFNSCQAYMELNLLQEATHSKFMHINPLIHTSNSTIPSKVIFHKGWSS-------- 95 H GAF+SC + N+LQ+ T++K MH+N L+ +ST P K +KGWSS Sbjct: 5 HNQGAFSSCLTHTIKNMLQDTTNAKLMHVNSLLRIVDSTGPVKFQCNKGWSSWFFSPNYT 64 Query: 94 -------FSHQIASRRWL 62 FSHQI S+RWL Sbjct: 65 NQLKLQRFSHQITSKRWL 82 Score = 42.4 bits (98), Expect(2) = 1e-14 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 62 DSISPENEYRSSRNIAISLF 3 DSISPENEYRSSRNIAISLF Sbjct: 87 DSISPENEYRSSRNIAISLF 106