BLASTX nr result
ID: Mentha23_contig00009661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00009661 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35038.1| hypothetical protein MIMGU_mgv1a019263mg, partial... 78 1e-12 ref|XP_004166887.1| PREDICTED: ATP-dependent Clp protease ATP-bi... 71 1e-10 ref|XP_004142810.1| PREDICTED: ATP-dependent Clp protease ATP-bi... 71 1e-10 ref|XP_002527823.1| ATP-dependent clp protease ATP-binding subun... 71 1e-10 ref|XP_006836922.1| hypothetical protein AMTR_s00099p00142540 [A... 71 2e-10 ref|XP_002268594.2| PREDICTED: ATP-dependent Clp protease ATP-bi... 71 2e-10 dbj|BAJ98835.1| predicted protein [Hordeum vulgare subsp. vulgare] 71 2e-10 emb|CBI29632.3| unnamed protein product [Vitis vinifera] 71 2e-10 emb|CAN80513.1| hypothetical protein VITISV_026067 [Vitis vinifera] 71 2e-10 gb|EXB80407.1| ATP-dependent Clp protease ATP-binding subunit Cl... 70 3e-10 ref|XP_006470836.1| PREDICTED: ATP-dependent Clp protease ATP-bi... 70 3e-10 gb|EMT28446.1| ATP-dependent Clp protease ATP-binding subunit cl... 70 3e-10 gb|EMS53220.1| ATP-dependent Clp protease ATP-binding subunit Cl... 70 3e-10 ref|XP_001768014.1| predicted protein [Physcomitrella patens] gi... 70 3e-10 ref|XP_006645143.1| PREDICTED: ATP-dependent Clp protease ATP-bi... 70 4e-10 ref|XP_006431435.1| hypothetical protein CICLE_v10003616mg [Citr... 70 4e-10 gb|AFW71882.1| hypothetical protein ZEAMMB73_870207 [Zea mays] 70 4e-10 gb|AFW71881.1| hypothetical protein ZEAMMB73_870207 [Zea mays] 70 4e-10 ref|XP_003575175.1| PREDICTED: ATP-dependent Clp protease ATP-bi... 70 4e-10 ref|XP_003575174.1| PREDICTED: ATP-dependent Clp protease ATP-bi... 70 4e-10 >gb|EYU35038.1| hypothetical protein MIMGU_mgv1a019263mg, partial [Mimulus guttatus] Length = 551 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLEHVE GDLTAYGLIPEFVGR PV+VSLSALDEDQLVQVL+ Sbjct: 386 LLEHVEGGDLTAYGLIPEFVGRFPVVVSLSALDEDQLVQVLT 427 >ref|XP_004166887.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like, partial [Cucumis sativus] Length = 298 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 +LE+VESGDL YGLIPEFVGR P++VSLSALDEDQLVQVL+ Sbjct: 124 MLENVESGDLITYGLIPEFVGRCPILVSLSALDEDQLVQVLT 165 >ref|XP_004142810.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like [Cucumis sativus] Length = 619 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 +LE+VESGDL YGLIPEFVGR P++VSLSALDEDQLVQVL+ Sbjct: 445 MLENVESGDLITYGLIPEFVGRCPILVSLSALDEDQLVQVLT 486 >ref|XP_002527823.1| ATP-dependent clp protease ATP-binding subunit clpx, putative [Ricinus communis] gi|223532747|gb|EEF34526.1| ATP-dependent clp protease ATP-binding subunit clpx, putative [Ricinus communis] Length = 603 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVL 124 LLE VESGDL AYGLIPEFVGR P++VSLSAL+EDQLVQVL Sbjct: 427 LLESVESGDLVAYGLIPEFVGRFPILVSLSALNEDQLVQVL 467 >ref|XP_006836922.1| hypothetical protein AMTR_s00099p00142540 [Amborella trichopoda] gi|548839486|gb|ERM99775.1| hypothetical protein AMTR_s00099p00142540 [Amborella trichopoda] Length = 709 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSLSAL+EDQLVQVL+ Sbjct: 533 LLESVESGDLMAYGLIPEFIGRFPILVSLSALNEDQLVQVLT 574 >ref|XP_002268594.2| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like [Vitis vinifera] Length = 637 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSLSAL+EDQLVQVL+ Sbjct: 461 LLESVESGDLIAYGLIPEFIGRFPILVSLSALNEDQLVQVLT 502 >dbj|BAJ98835.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 637 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSLSAL+EDQLVQVL+ Sbjct: 465 LLESVESGDLIAYGLIPEFIGRFPILVSLSALNEDQLVQVLT 506 >emb|CBI29632.3| unnamed protein product [Vitis vinifera] Length = 545 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSLSAL+EDQLVQVL+ Sbjct: 369 LLESVESGDLIAYGLIPEFIGRFPILVSLSALNEDQLVQVLT 410 >emb|CAN80513.1| hypothetical protein VITISV_026067 [Vitis vinifera] Length = 469 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSLSAL+EDQLVQVL+ Sbjct: 293 LLESVESGDLIAYGLIPEFIGRFPILVSLSALNEDQLVQVLT 334 >gb|EXB80407.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis] Length = 379 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYG+IPEFVGRLP++V LSAL+EDQLVQVL+ Sbjct: 209 LLESVESGDLIAYGMIPEFVGRLPILVCLSALNEDQLVQVLT 250 >ref|XP_006470836.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial-like [Citrus sinensis] Length = 592 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE V+SGDL AYGLIPEF+GR P++VSLSAL+EDQLVQVL+ Sbjct: 420 LLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLT 461 >gb|EMT28446.1| ATP-dependent Clp protease ATP-binding subunit clpX [Aegilops tauschii] Length = 588 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL +GLIPEF+GRLP++VSL+ALDEDQLVQVL+ Sbjct: 253 LLESVESGDLAKFGLIPEFIGRLPILVSLAALDEDQLVQVLT 294 >gb|EMS53220.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Triticum urartu] Length = 401 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL +GLIPEF+GRLP++VSL+ALDEDQLVQVL+ Sbjct: 226 LLESVESGDLAKFGLIPEFIGRLPILVSLAALDEDQLVQVLT 267 >ref|XP_001768014.1| predicted protein [Physcomitrella patens] gi|162680856|gb|EDQ67289.1| predicted protein [Physcomitrella patens] Length = 446 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VES DL +YGLIPEF+GR PVIVSLSALDEDQLVQVL+ Sbjct: 259 LLETVESSDLISYGLIPEFIGRFPVIVSLSALDEDQLVQVLT 300 >ref|XP_006645143.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial-like [Oryza brachyantha] Length = 503 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL YGLIPEF+GRLP++VSL+AL+EDQLVQVL+ Sbjct: 328 LLESVESGDLARYGLIPEFIGRLPILVSLTALNEDQLVQVLT 369 >ref|XP_006431435.1| hypothetical protein CICLE_v10003616mg [Citrus clementina] gi|557533557|gb|ESR44675.1| hypothetical protein CICLE_v10003616mg [Citrus clementina] Length = 592 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVL 124 LLE V+SGDL AYGLIPEF+GR P++VSLSAL+EDQLVQVL Sbjct: 420 LLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVL 460 >gb|AFW71882.1| hypothetical protein ZEAMMB73_870207 [Zea mays] Length = 642 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSL+AL+EDQLVQVL+ Sbjct: 470 LLESVESGDLIAYGLIPEFIGRFPILVSLTALNEDQLVQVLT 511 >gb|AFW71881.1| hypothetical protein ZEAMMB73_870207 [Zea mays] Length = 643 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSL+AL+EDQLVQVL+ Sbjct: 471 LLESVESGDLIAYGLIPEFIGRFPILVSLTALNEDQLVQVLT 512 >ref|XP_003575175.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like isoform 2 [Brachypodium distachyon] Length = 658 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSL+AL+EDQLVQVL+ Sbjct: 486 LLESVESGDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLT 527 >ref|XP_003575174.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like isoform 1 [Brachypodium distachyon] Length = 640 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 LLEHVESGDLTAYGLIPEFVGRLPVIVSLSALDEDQLVQVLS 127 LLE VESGDL AYGLIPEF+GR P++VSL+AL+EDQLVQVL+ Sbjct: 468 LLESVESGDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLT 509