BLASTX nr result
ID: Mentha23_contig00009337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00009337 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40406.1| hypothetical protein MIMGU_mgv1a009528mg [Mimulus... 74 2e-11 gb|EXB36846.1| putative aquaporin PIP1-4 [Morus notabilis] 59 5e-07 gb|EPS60236.1| hypothetical protein M569_14568, partial [Genlise... 57 2e-06 >gb|EYU40406.1| hypothetical protein MIMGU_mgv1a009528mg [Mimulus guttatus] Length = 339 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 321 GPGIACVAFYLYTKIIPSQHHKSKAYDHDVYNVFKVMF 208 GPGIACVAFYLYTKIIP HH+SKAYDHD YN+ KV+F Sbjct: 294 GPGIACVAFYLYTKIIPRNHHRSKAYDHDFYNIVKVVF 331 >gb|EXB36846.1| putative aquaporin PIP1-4 [Morus notabilis] Length = 325 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 321 GPGIACVAFYLYTKIIPSQHHKSKAYDHDVYNVFKVMF 208 GP IACVAFYLYTKIIP QH+ ++ Y HD +NV K +F Sbjct: 288 GPTIACVAFYLYTKIIPRQHYHAEGYKHDFFNVVKSLF 325 >gb|EPS60236.1| hypothetical protein M569_14568, partial [Genlisea aurea] Length = 107 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -2 Query: 321 GPGIACVAFYLYTKIIPSQHHKSK-AYDHDVYNVFKVMFG 205 GPGIA V FY+Y KIIPSQHH+ K +YDHD +V ++FG Sbjct: 68 GPGIASVLFYVYVKIIPSQHHRPKHSYDHDFLHVINILFG 107