BLASTX nr result
ID: Mentha23_contig00009120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00009120 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74374.1| hypothetical protein M569_00381 [Genlisea aurea] 55 8e-06 >gb|EPS74374.1| hypothetical protein M569_00381 [Genlisea aurea] Length = 404 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/48 (62%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = -1 Query: 142 MTTYYHGGNSEIQGG-DGLQTLILMNPAYVGYSDDXXXXXXXXQSNGN 2 M TYYHG +SEIQGG DGLQTLILMNPA+VGY D + GN Sbjct: 1 MGTYYHG-DSEIQGGGDGLQTLILMNPAFVGYGDGQQAPPSGAVAQGN 47