BLASTX nr result
ID: Mentha23_contig00009084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00009084 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534575.2| PREDICTED: K(+) efflux antiporter 2, chlorop... 59 9e-07 gb|EXC16354.1| K(+) efflux antiporter 2 [Morus notabilis] 57 2e-06 ref|XP_007220297.1| hypothetical protein PRUPE_ppa000383mg [Prun... 56 5e-06 >ref|XP_003534575.2| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like isoform X1 [Glycine max] gi|571479436|ref|XP_006587859.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like isoform X2 [Glycine max] Length = 1202 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +3 Query: 3 ELSETSGSSLGYGFSQMMNKPKQPLPDASDELP--EGTLAI 119 EL E SGSSLGYGF+++MNKPK P PD+ DE P EGTLAI Sbjct: 1162 ELCEASGSSLGYGFNRIMNKPKSPSPDSLDETPVSEGTLAI 1202 >gb|EXC16354.1| K(+) efflux antiporter 2 [Morus notabilis] Length = 527 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/40 (72%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +3 Query: 3 ELSETSGSSLGYGFSQMMNKPKQPLPDASDE-LPEGTLAI 119 EL +TSGSSLGYGFS++MNKPK P D+SDE + EGTLAI Sbjct: 488 ELCQTSGSSLGYGFSRVMNKPKAPSSDSSDESVTEGTLAI 527 >ref|XP_007220297.1| hypothetical protein PRUPE_ppa000383mg [Prunus persica] gi|462416759|gb|EMJ21496.1| hypothetical protein PRUPE_ppa000383mg [Prunus persica] Length = 1223 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +3 Query: 3 ELSETSGSSLGYGFSQMMNKPKQPLPDASDE--LPEGTLAI 119 EL ETSGSSLGYGFS+MM+KPK P D++DE EGTLAI Sbjct: 1183 ELCETSGSSLGYGFSRMMSKPKPPSSDSTDENQFTEGTLAI 1223