BLASTX nr result
ID: Mentha23_contig00008968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00008968 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33662.1| hypothetical protein MIMGU_mgv1a006529mg [Mimulus... 61 1e-07 >gb|EYU33662.1| hypothetical protein MIMGU_mgv1a006529mg [Mimulus guttatus] Length = 440 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -1 Query: 448 VSLSEERLEEVKELIFEAISCCIEGGAVGMTKAEESGSTHQPHEDADAIK 299 VSLSEERLEEVKELIFEAI C +E G + EES + H+DADA+K Sbjct: 379 VSLSEERLEEVKELIFEAICCNVEEGVLPPITVEESDDAAESHDDADALK 428