BLASTX nr result
ID: Mentha23_contig00008909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00008909 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19704.1| hypothetical protein MIMGU_mgv1a006312mg [Mimulus... 82 8e-14 gb|EPS67210.1| hypothetical protein M569_07556, partial [Genlise... 80 2e-13 gb|EPS59498.1| hypothetical protein M569_15307, partial [Genlise... 79 5e-13 ref|XP_002270121.1| PREDICTED: uncharacterized calcium-binding p... 79 9e-13 emb|CAN73791.1| hypothetical protein VITISV_034892 [Vitis vinifera] 79 9e-13 gb|EYU45333.1| hypothetical protein MIMGU_mgv1a006690mg [Mimulus... 77 3e-12 gb|EXC13633.1| hypothetical protein L484_019591 [Morus notabilis] 77 3e-12 ref|XP_006583191.1| PREDICTED: uncharacterized calcium-binding p... 77 3e-12 ref|XP_003529863.2| PREDICTED: uncharacterized calcium-binding p... 77 3e-12 dbj|BAA97135.1| unnamed protein product [Arabidopsis thaliana] 76 4e-12 ref|XP_006598859.1| PREDICTED: uncharacterized calcium-binding p... 76 4e-12 ref|XP_006401624.1| hypothetical protein EUTSA_v10013580mg [Eutr... 76 4e-12 ref|XP_006401623.1| hypothetical protein EUTSA_v10013580mg [Eutr... 76 4e-12 ref|XP_006280488.1| hypothetical protein CARUB_v10026428mg [Caps... 76 4e-12 ref|XP_004307900.1| PREDICTED: uncharacterized calcium-binding p... 76 4e-12 ref|XP_007218007.1| hypothetical protein PRUPE_ppa005781mg [Prun... 76 4e-12 ref|NP_001078754.1| calcium-binding endonuclease/exonuclease/pho... 76 4e-12 ref|XP_003548000.1| PREDICTED: uncharacterized calcium-binding p... 76 4e-12 ref|XP_002864303.1| calcium ion binding protein [Arabidopsis lyr... 76 4e-12 gb|ACW82436.1| calcium binding protein [Lepidium latifolium] 76 4e-12 >gb|EYU19704.1| hypothetical protein MIMGU_mgv1a006312mg [Mimulus guttatus] Length = 449 Score = 82.0 bits (201), Expect = 8e-14 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNICGVDFIWLLNPNRYMKLLKT W E L Sbjct: 256 KWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTSWSEAL 293 >gb|EPS67210.1| hypothetical protein M569_07556, partial [Genlisea aurea] Length = 440 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +W+SHRNHRGNICGVDFIWLLNPNRY KLLKT WGE + Sbjct: 256 KWISHRNHRGNICGVDFIWLLNPNRYRKLLKTSWGEAV 293 >gb|EPS59498.1| hypothetical protein M569_15307, partial [Genlisea aurea] Length = 351 Score = 79.3 bits (194), Expect = 5e-13 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +W+SHRNHRGNICGVDFIWLLNPNRY KLL+T WGE + Sbjct: 178 KWISHRNHRGNICGVDFIWLLNPNRYRKLLRTSWGEAV 215 >ref|XP_002270121.1| PREDICTED: uncharacterized calcium-binding protein At1g02270 [Vitis vinifera] gi|302144002|emb|CBI23107.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNICGVDFIWLLNPNRY KLLKT W E + Sbjct: 257 KWVSHRNHRGNICGVDFIWLLNPNRYRKLLKTSWSEAV 294 >emb|CAN73791.1| hypothetical protein VITISV_034892 [Vitis vinifera] Length = 445 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNICGVDFIWLLNPNRY KLLKT W E + Sbjct: 251 KWVSHRNHRGNICGVDFIWLLNPNRYRKLLKTSWSEAV 288 >gb|EYU45333.1| hypothetical protein MIMGU_mgv1a006690mg [Mimulus guttatus] Length = 435 Score = 76.6 bits (187), Expect = 3e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNICGVDFIWLLNPN Y KLLKT W E + Sbjct: 255 KWVSHRNHRGNICGVDFIWLLNPNSYRKLLKTSWSEAI 292 >gb|EXC13633.1| hypothetical protein L484_019591 [Morus notabilis] Length = 473 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/67 (53%), Positives = 43/67 (64%) Frame = +1 Query: 1 YQCTCTQGNFIYFSILKKNSDSIPSFLQWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTG 180 Y+ +QG + K SD+ QWVSHRNHRGNICGVDFIWL NPN+ K LKT Sbjct: 246 YKFLRSQGFESTYDTAHKYSDNDVEAHQWVSHRNHRGNICGVDFIWLCNPNKSRKPLKTS 305 Query: 181 WGETLIA 201 WGE + + Sbjct: 306 WGEAVFS 312 >ref|XP_006583191.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like isoform X2 [Glycine max] Length = 472 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = +1 Query: 1 YQCTCTQGNFIYFSILKKNSDSIPSFLQWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTG 180 Y+ +QG + I + SDS +WVSHRNHRGNICGVDFIWL NPN+ K LKT Sbjct: 252 YKFLRSQGFVSSYDIANRYSDSYADAHKWVSHRNHRGNICGVDFIWLCNPNQARKPLKTS 311 Query: 181 WGETLIA 201 W E + + Sbjct: 312 WAEAVFS 318 >ref|XP_003529863.2| PREDICTED: uncharacterized calcium-binding protein At1g02270-like isoform X1 [Glycine max] Length = 473 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = +1 Query: 1 YQCTCTQGNFIYFSILKKNSDSIPSFLQWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTG 180 Y+ +QG + I + SDS +WVSHRNHRGNICGVDFIWL NPN+ K LKT Sbjct: 252 YKFLRSQGFVSSYDIANRYSDSYADAHKWVSHRNHRGNICGVDFIWLCNPNQARKPLKTS 311 Query: 181 WGETLIA 201 W E + + Sbjct: 312 WAEAVFS 318 >dbj|BAA97135.1| unnamed protein product [Arabidopsis thaliana] Length = 232 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNIC VDFIWLLNPNRY KLLKT W E + Sbjct: 43 KWVSHRNHRGNICAVDFIWLLNPNRYRKLLKTSWSEAV 80 >ref|XP_006598859.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like isoform X2 [Glycine max] Length = 472 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = +1 Query: 1 YQCTCTQGNFIYFSILKKNSDSIPSFLQWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTG 180 Y+ +QG + I + SDS +WVSHRNHRGNICGVDFIWL NPN+ K LKT Sbjct: 252 YKFLRSQGFVSSYDIANQYSDSYADSHKWVSHRNHRGNICGVDFIWLCNPNQARKPLKTS 311 Query: 181 WGETLIA 201 W E + + Sbjct: 312 WAEAVFS 318 >ref|XP_006401624.1| hypothetical protein EUTSA_v10013580mg [Eutrema salsugineum] gi|557102714|gb|ESQ43077.1| hypothetical protein EUTSA_v10013580mg [Eutrema salsugineum] Length = 335 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNIC VDFIWLLNPNRY KLLKT W E + Sbjct: 248 KWVSHRNHRGNICAVDFIWLLNPNRYRKLLKTSWSEAV 285 >ref|XP_006401623.1| hypothetical protein EUTSA_v10013580mg [Eutrema salsugineum] gi|557102713|gb|ESQ43076.1| hypothetical protein EUTSA_v10013580mg [Eutrema salsugineum] Length = 437 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNIC VDFIWLLNPNRY KLLKT W E + Sbjct: 248 KWVSHRNHRGNICAVDFIWLLNPNRYRKLLKTSWSEAV 285 >ref|XP_006280488.1| hypothetical protein CARUB_v10026428mg [Capsella rubella] gi|482549192|gb|EOA13386.1| hypothetical protein CARUB_v10026428mg [Capsella rubella] Length = 436 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNIC VDFIWLLNPNRY KLLKT W E + Sbjct: 247 KWVSHRNHRGNICAVDFIWLLNPNRYRKLLKTSWSEAV 284 >ref|XP_004307900.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Fragaria vesca subsp. vesca] Length = 443 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNICGVDFIWLLNPN Y KLLKT W E + Sbjct: 255 KWVSHRNHRGNICGVDFIWLLNPNSYRKLLKTSWSEAV 292 >ref|XP_007218007.1| hypothetical protein PRUPE_ppa005781mg [Prunus persica] gi|462414469|gb|EMJ19206.1| hypothetical protein PRUPE_ppa005781mg [Prunus persica] Length = 444 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNICGVDFIWLLNPN Y KLLKT W E + Sbjct: 251 KWVSHRNHRGNICGVDFIWLLNPNSYRKLLKTSWSEAV 288 >ref|NP_001078754.1| calcium-binding endonuclease/exonuclease/phosphatase family protein [Arabidopsis thaliana] gi|27311783|gb|AAO00857.1| putative protein [Arabidopsis thaliana] gi|30387507|gb|AAP31919.1| At5g54130 [Arabidopsis thaliana] gi|51970738|dbj|BAD44061.1| putative protein [Arabidopsis thaliana] gi|332009070|gb|AED96453.1| calcium-binding endonuclease/exonuclease/phosphatase family protein [Arabidopsis thaliana] Length = 436 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNIC VDFIWLLNPNRY KLLKT W E + Sbjct: 247 KWVSHRNHRGNICAVDFIWLLNPNRYRKLLKTSWSEAV 284 >ref|XP_003548000.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like isoform X1 [Glycine max] Length = 473 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = +1 Query: 1 YQCTCTQGNFIYFSILKKNSDSIPSFLQWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTG 180 Y+ +QG + I + SDS +WVSHRNHRGNICGVDFIWL NPN+ K LKT Sbjct: 252 YKFLRSQGFVSSYDIANQYSDSYADSHKWVSHRNHRGNICGVDFIWLCNPNQARKPLKTS 311 Query: 181 WGETLIA 201 W E + + Sbjct: 312 WAEAVFS 318 >ref|XP_002864303.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297310138|gb|EFH40562.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata] Length = 437 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNIC VDFIWLLNPNRY KLLKT W E + Sbjct: 248 KWVSHRNHRGNICAVDFIWLLNPNRYRKLLKTSWSEAV 285 >gb|ACW82436.1| calcium binding protein [Lepidium latifolium] Length = 436 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 82 QWVSHRNHRGNICGVDFIWLLNPNRYMKLLKTGWGETL 195 +WVSHRNHRGNIC VDFIWLLNPNRY KLLKT W E + Sbjct: 247 KWVSHRNHRGNICAVDFIWLLNPNRYRKLLKTSWSEAV 284