BLASTX nr result
ID: Mentha23_contig00008867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00008867 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65326.1| 60S ribosomal protein L23A [Morus notabilis] 79 8e-13 ref|NP_191088.1| 60S ribosomal protein L23a-2 [Arabidopsis thali... 79 8e-13 ref|XP_006597283.1| PREDICTED: 60S ribosomal protein L23a-like i... 79 8e-13 ref|XP_006403475.1| hypothetical protein EUTSA_v10010790mg [Eutr... 79 8e-13 ref|XP_006400921.1| hypothetical protein EUTSA_v10015923mg, part... 79 8e-13 ref|XP_006411174.1| hypothetical protein EUTSA_v10017366mg [Eutr... 79 8e-13 ref|XP_002314202.2| hypothetical protein POPTR_0009s03210g [Popu... 79 8e-13 ref|XP_007009533.1| Ribosomal protein L23AB isoform 1 [Theobroma... 79 8e-13 ref|XP_006295046.1| hypothetical protein CARUB_v10024114mg [Caps... 79 8e-13 ref|XP_006291990.1| hypothetical protein CARUB_v10018178mg [Caps... 79 8e-13 ref|XP_004307560.1| PREDICTED: 60S ribosomal protein L23a-like [... 79 8e-13 ref|XP_007218545.1| hypothetical protein PRUPE_ppa012791mg [Prun... 79 8e-13 ref|XP_004149813.1| PREDICTED: 60S ribosomal protein L23a-like [... 79 8e-13 ref|XP_004147702.1| PREDICTED: 60S ribosomal protein L23a-like [... 79 8e-13 ref|XP_004140409.1| PREDICTED: 60S ribosomal protein L23a-like i... 79 8e-13 ref|XP_004140408.1| PREDICTED: 60S ribosomal protein L23a-like i... 79 8e-13 ref|XP_004140407.1| PREDICTED: 60S ribosomal protein L23a-like i... 79 8e-13 gb|ABB97038.1| unknown [Brassica rapa] 79 8e-13 gb|AAM64290.1| 60S ribosomal protein L23A [Arabidopsis thaliana] 79 8e-13 ref|NP_181478.1| 60S ribosomal protein L23a-1 [Arabidopsis thali... 79 8e-13 >gb|EXB65326.1| 60S ribosomal protein L23A [Morus notabilis] Length = 153 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 113 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 149 >ref|NP_191088.1| 60S ribosomal protein L23a-2 [Arabidopsis thaliana] gi|145332855|ref|NP_001078293.1| 60S ribosomal protein L23a-2 [Arabidopsis thaliana] gi|73914092|sp|Q9M3C3.1|R23A2_ARATH RecName: Full=60S ribosomal protein L23a-2 gi|7019661|emb|CAB75762.1| ribosomal L23a-like protein [Arabidopsis thaliana] gi|15215831|gb|AAK91460.1| AT3g55280/T26I12_160 [Arabidopsis thaliana] gi|21553861|gb|AAM62954.1| ribosomal L23a-like protein [Arabidopsis thaliana] gi|23308155|gb|AAN18047.1| At3g55280/T26I12_160 [Arabidopsis thaliana] gi|332645841|gb|AEE79362.1| 60S ribosomal protein L23a-2 [Arabidopsis thaliana] gi|332645842|gb|AEE79363.1| 60S ribosomal protein L23a-2 [Arabidopsis thaliana] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150 >ref|XP_006597283.1| PREDICTED: 60S ribosomal protein L23a-like isoform X2 [Glycine max] Length = 152 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 112 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 148 >ref|XP_006403475.1| hypothetical protein EUTSA_v10010790mg [Eutrema salsugineum] gi|567186289|ref|XP_006403476.1| hypothetical protein EUTSA_v10010790mg [Eutrema salsugineum] gi|567186292|ref|XP_006403477.1| hypothetical protein EUTSA_v10010790mg [Eutrema salsugineum] gi|567186296|ref|XP_006403478.1| hypothetical protein EUTSA_v10010790mg [Eutrema salsugineum] gi|557104594|gb|ESQ44928.1| hypothetical protein EUTSA_v10010790mg [Eutrema salsugineum] gi|557104595|gb|ESQ44929.1| hypothetical protein EUTSA_v10010790mg [Eutrema salsugineum] gi|557104596|gb|ESQ44930.1| hypothetical protein EUTSA_v10010790mg [Eutrema salsugineum] gi|557104597|gb|ESQ44931.1| hypothetical protein EUTSA_v10010790mg [Eutrema salsugineum] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150 >ref|XP_006400921.1| hypothetical protein EUTSA_v10015923mg, partial [Eutrema salsugineum] gi|557102011|gb|ESQ42374.1| hypothetical protein EUTSA_v10015923mg, partial [Eutrema salsugineum] Length = 126 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 86 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 122 >ref|XP_006411174.1| hypothetical protein EUTSA_v10017366mg [Eutrema salsugineum] gi|567214565|ref|XP_006411175.1| hypothetical protein EUTSA_v10017366mg [Eutrema salsugineum] gi|557112343|gb|ESQ52627.1| hypothetical protein EUTSA_v10017366mg [Eutrema salsugineum] gi|557112344|gb|ESQ52628.1| hypothetical protein EUTSA_v10017366mg [Eutrema salsugineum] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150 >ref|XP_002314202.2| hypothetical protein POPTR_0009s03210g [Populus trichocarpa] gi|566186063|ref|XP_006379008.1| hypothetical protein POPTR_0009s03210g [Populus trichocarpa] gi|550330936|gb|EEE88157.2| hypothetical protein POPTR_0009s03210g [Populus trichocarpa] gi|550330937|gb|ERP56805.1| hypothetical protein POPTR_0009s03210g [Populus trichocarpa] Length = 152 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 112 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 148 >ref|XP_007009533.1| Ribosomal protein L23AB isoform 1 [Theobroma cacao] gi|508726446|gb|EOY18343.1| Ribosomal protein L23AB isoform 1 [Theobroma cacao] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150 >ref|XP_006295046.1| hypothetical protein CARUB_v10024114mg [Capsella rubella] gi|482563754|gb|EOA27944.1| hypothetical protein CARUB_v10024114mg [Capsella rubella] Length = 193 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 153 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 189 >ref|XP_006291990.1| hypothetical protein CARUB_v10018178mg [Capsella rubella] gi|482560697|gb|EOA24888.1| hypothetical protein CARUB_v10018178mg [Capsella rubella] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150 >ref|XP_004307560.1| PREDICTED: 60S ribosomal protein L23a-like [Fragaria vesca subsp. vesca] Length = 152 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 112 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 148 >ref|XP_007218545.1| hypothetical protein PRUPE_ppa012791mg [Prunus persica] gi|462415007|gb|EMJ19744.1| hypothetical protein PRUPE_ppa012791mg [Prunus persica] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150 >ref|XP_004149813.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus] gi|449519086|ref|XP_004166566.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus] Length = 153 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 113 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 149 >ref|XP_004147702.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus] gi|449514958|ref|XP_004164525.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus] Length = 153 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 113 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 149 >ref|XP_004140409.1| PREDICTED: 60S ribosomal protein L23a-like isoform 3 [Cucumis sativus] gi|449498367|ref|XP_004160519.1| PREDICTED: 60S ribosomal protein L23a-like isoform 3 [Cucumis sativus] Length = 146 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 106 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 142 >ref|XP_004140408.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Cucumis sativus] gi|449498363|ref|XP_004160518.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Cucumis sativus] Length = 152 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 112 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 148 >ref|XP_004140407.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Cucumis sativus] gi|449497783|ref|XP_004160517.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Cucumis sativus] Length = 153 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 113 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 149 >gb|ABB97038.1| unknown [Brassica rapa] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150 >gb|AAM64290.1| 60S ribosomal protein L23A [Arabidopsis thaliana] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150 >ref|NP_181478.1| 60S ribosomal protein L23a-1 [Arabidopsis thaliana] gi|238479508|ref|NP_001154565.1| 60S ribosomal protein L23a-1 [Arabidopsis thaliana] gi|73914091|sp|Q8LD46.2|R23A1_ARATH RecName: Full=60S ribosomal protein L23a-1; Short=AtRPL23A-1 gi|11762271|gb|AAG40408.1|AF325056_1 At2g39460 [Arabidopsis thaliana] gi|3355475|gb|AAC27837.1| 60S ribosomal protein L23A [Arabidopsis thaliana] gi|14335112|gb|AAK59835.1| At2g39460/F12L6.12 [Arabidopsis thaliana] gi|14532452|gb|AAK63954.1| At2g39460/F12L6.12 [Arabidopsis thaliana] gi|16974523|gb|AAL31171.1| At2g39460/F12L6.12 [Arabidopsis thaliana] gi|330254586|gb|AEC09680.1| 60S ribosomal protein L23a-1 [Arabidopsis thaliana] gi|330254587|gb|AEC09681.1| 60S ribosomal protein L23a-1 [Arabidopsis thaliana] Length = 154 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 440 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 330 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK Sbjct: 114 MYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANK 150