BLASTX nr result
ID: Mentha23_contig00008776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00008776 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38641.1| hypothetical protein MIMGU_mgv1a014207mg [Mimulus... 58 1e-06 >gb|EYU38641.1| hypothetical protein MIMGU_mgv1a014207mg [Mimulus guttatus] Length = 197 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/62 (46%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = +3 Query: 6 DEDDGDDARIENSAAMEVDAPKCQSSLDQNESVADETCMKD-DPQVDDEWTVVSSRRGKE 182 D ++ D +NS+ ME+DAPK QSS Q +S+ D+T ++ PQV D WTVV SRR K Sbjct: 135 DNNEDDTLSKDNSSEMEIDAPKSQSSPSQKDSLPDQTSQRETPPQVVDGWTVVPSRRSKG 194 Query: 183 RR 188 ++ Sbjct: 195 KK 196