BLASTX nr result
ID: Mentha23_contig00008747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00008747 (536 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35651.1| hypothetical protein MIMGU_mgv1a005476mg [Mimulus... 71 1e-10 gb|EPS67604.1| hypothetical protein M569_07168, partial [Genlise... 59 6e-07 >gb|EYU35651.1| hypothetical protein MIMGU_mgv1a005476mg [Mimulus guttatus] Length = 482 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 1 ALSFMMWRTNWDEEVLKASARLKKWYLKSPEEISSKPELA 120 ALSFMMWRTNWDEEVLKAS RL+KWYLKSPEE + K + A Sbjct: 443 ALSFMMWRTNWDEEVLKASTRLRKWYLKSPEEANRKSDEA 482 >gb|EPS67604.1| hypothetical protein M569_07168, partial [Genlisea aurea] Length = 207 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 ALSFMMWRTNWDEEVLKASARLKKWYLKSPEE 96 AL MMWRTNWD+EVLK + RL+KWYLKSPEE Sbjct: 175 ALVVMMWRTNWDDEVLKTTNRLRKWYLKSPEE 206