BLASTX nr result
ID: Mentha23_contig00008163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00008163 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota] 58 2e-06 >dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota] Length = 988 Score = 57.8 bits (138), Expect = 2e-06 Identities = 35/129 (27%), Positives = 64/129 (49%) Frame = -3 Query: 393 GGSKSCLQYAEELASERGVETKDCLYDAFQYMHKMEDGSYTDVKSARIAKEIEQLAEELR 214 GGS S +A LA G + + K + ++ K+ + ++ ++ EE Sbjct: 816 GGSASLRTHAAVLAETNGKDPTPADVYLLTHTKKRDKKTFVTKKAEAVYNKVIEIREERS 875 Query: 213 QPLPGTTEAREVDMNKCYLEVTKGLDNKGRLFGGGSLAQSIMSYDSTATSVSTSHVDKEA 34 +P+ G+ E + VD ++ +LE GLD + R++G GSL QS++ + +S STS Sbjct: 876 KPIEGSDEPQIVDEDEIFLEAVGGLDKRNRIYGLGSL-QSVIYGPESKSSTSTSRYSGSN 934 Query: 33 IDTRFEEME 7 + +E M+ Sbjct: 935 FNKEYELMQ 943