BLASTX nr result
ID: Mentha23_contig00007903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00007903 (781 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32451.1| hypothetical protein MIMGU_mgv1a015548mg [Mimulus... 63 1e-07 gb|EMS48065.1| Non-symbiotic hemoglobin 1 [Triticum urartu] 48 2e-07 >gb|EYU32451.1| hypothetical protein MIMGU_mgv1a015548mg [Mimulus guttatus] Length = 153 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +2 Query: 353 MGGFSEKQEALVKESWEVMKHNIPDLSLRFFSLL 454 MG FSEKQEALVKESWE+++HNIP+LSLRFF+L+ Sbjct: 1 MGSFSEKQEALVKESWEIIRHNIPELSLRFFTLI 34 >gb|EMS48065.1| Non-symbiotic hemoglobin 1 [Triticum urartu] Length = 88 Score = 47.8 bits (112), Expect(2) = 2e-07 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +3 Query: 456 ETSTGEKWSEEMSVAWEEAYDHLAKAIKDEMKAEAAS 566 E + E W+ EM AWEEAYD LA AIK+EMK AA+ Sbjct: 52 EGAVPEMWTPEMKAAWEEAYDQLAAAIKEEMKFAAAA 88 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +2 Query: 359 GFSEKQEALVKESWEVMKHNIPDLSLRFF 445 GFSE QE LV SW+ MK + ++L+FF Sbjct: 2 GFSEAQEELVLRSWKAMKPDSESIALKFF 30