BLASTX nr result
ID: Mentha23_contig00007808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00007808 (526 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524810.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_004247492.1| PREDICTED: uncharacterized protein LOC101268... 59 5e-07 ref|XP_002321059.2| hypothetical protein POPTR_0014s13430g [Popu... 57 2e-06 gb|EYU46624.1| hypothetical protein MIMGU_mgv1a007636mg [Mimulus... 56 5e-06 >ref|XP_002524810.1| conserved hypothetical protein [Ricinus communis] gi|223535994|gb|EEF37653.1| conserved hypothetical protein [Ricinus communis] Length = 419 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +1 Query: 334 RPTLVDVQDIHPQSLLLGFGIAEQCTRQEKILEVLASGSIEVE 462 RP L+DVQD P S+L FGIAEQCT+ EKIL+ L SGS E+E Sbjct: 81 RPVLIDVQDTCPDSVLFSFGIAEQCTKHEKILKFLTSGSSELE 123 >ref|XP_004247492.1| PREDICTED: uncharacterized protein LOC101268799 [Solanum lycopersicum] Length = 427 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = +1 Query: 319 VKNSRRPTLVDVQDIHPQSLLLGFGIAEQCTRQEKILEVLASGSIEVEDG 468 + S P L+D +D H S+LL FGIAEQCTRQE IL+ L SGS +VE G Sbjct: 74 LSTSEGPELIDARDDHLNSVLLSFGIAEQCTRQENILKYLRSGSNDVESG 123 >ref|XP_002321059.2| hypothetical protein POPTR_0014s13430g [Populus trichocarpa] gi|550324122|gb|EEE99374.2| hypothetical protein POPTR_0014s13430g [Populus trichocarpa] Length = 419 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +1 Query: 331 RRPTLVDVQDIHPQSLLLGFGIAEQCTRQEKILEVLASGSIEVE 462 R PTL+DVQD P S+L FGI E+CTRQEKIL+ L S S ++E Sbjct: 82 RTPTLIDVQDARPDSVLFSFGIVEKCTRQEKILQFLMSESNKLE 125 >gb|EYU46624.1| hypothetical protein MIMGU_mgv1a007636mg [Mimulus guttatus] Length = 400 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = +1 Query: 328 SRRPTLVDVQDIHPQSLLLGFGIAEQCTRQEKILEVLASGSIEVEDGLV 474 S+RP L+D Q+ HP S+ +GI ++CTR E+IL++LAS S+E GLV Sbjct: 73 SKRPPLIDFQETHPDSIHFSYGIVDRCTRHEQILKLLASKSVEEIGGLV 121