BLASTX nr result
ID: Mentha23_contig00007336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00007336 (677 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432292.1| hypothetical protein CICLE_v10003975mg [Citr... 58 3e-06 >ref|XP_006432292.1| hypothetical protein CICLE_v10003975mg [Citrus clementina] gi|557534414|gb|ESR45532.1| hypothetical protein CICLE_v10003975mg [Citrus clementina] Length = 339 Score = 57.8 bits (138), Expect = 3e-06 Identities = 39/142 (27%), Positives = 68/142 (47%), Gaps = 2/142 (1%) Frame = +2 Query: 209 RDLSTIRSRYDIPQSYSLALSSGPERADWRINGWTTMYELHPKEVARLPLPKFLLEICNY 388 +++ +R Y IP +L L E A NG T +Y + RLP+ + + Sbjct: 94 KEIEELRKEYLIPDDLTLRLLGEDEVASKLSNGETAIYLEMLELGFRLPIQPYFARMLVR 153 Query: 389 HGISPSQLIPSVWCILMATKR-FGEKKEI*LTCAEFLTVYHL-QRSKNDYGRYMLVNQLK 562 G+SPSQL P+ W +L + E+ + EF +Y + N G Y ++++K Sbjct: 154 VGLSPSQLDPNGWRVLGGMYVVWAEQNKTEPCFKEFTHLYFCNEHGINHKGWYYFMSKIK 213 Query: 563 ENRLIFEKKSSDRGWQSRYFFI 628 R++ + S RGW+++YF + Sbjct: 214 SRRIVLDFPGSCRGWKNKYFVV 235