BLASTX nr result
ID: Mentha23_contig00007132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00007132 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB10562.1| unnamed protein product [Arabidopsis thaliana] 63 5e-08 gb|EYU22249.1| hypothetical protein MIMGU_mgv1a0049472mg, partia... 62 6e-08 gb|EXB90594.1| Tetratricopeptide repeat protein 37 [Morus notabi... 62 1e-07 ref|XP_006476944.1| PREDICTED: UDP-N-acetylglucosamine--peptide ... 62 1e-07 ref|XP_006476942.1| PREDICTED: UDP-N-acetylglucosamine--peptide ... 62 1e-07 ref|XP_006440000.1| hypothetical protein CICLE_v10019194mg [Citr... 62 1e-07 ref|XP_006439999.1| hypothetical protein CICLE_v10019194mg [Citr... 62 1e-07 gb|EPS73253.1| hypothetical protein M569_01502 [Genlisea aurea] 58 2e-06 ref|XP_007210884.1| hypothetical protein PRUPE_ppa002631mg [Prun... 57 2e-06 ref|XP_007037847.1| Tetratricopeptide repeat (TPR)-containing pr... 57 3e-06 ref|XP_004299179.1| PREDICTED: probable UDP-N-acetylglucosamine-... 57 3e-06 ref|XP_002318101.2| tetratricopeptide repeat-containing family p... 57 3e-06 ref|XP_002511271.1| o-linked n-acetylglucosamine transferase, og... 56 4e-06 ref|XP_006281757.1| hypothetical protein CARUB_v10027919mg [Caps... 56 6e-06 ref|XP_006347418.1| PREDICTED: probable UDP-N-acetylglucosamine-... 55 8e-06 ref|XP_006347417.1| PREDICTED: probable UDP-N-acetylglucosamine-... 55 8e-06 ref|XP_004241497.1| PREDICTED: probable UDP-N-acetylglucosamine-... 55 8e-06 ref|XP_004152504.1| PREDICTED: probable UDP-N-acetylglucosamine-... 55 1e-05 >dbj|BAB10562.1| unnamed protein product [Arabidopsis thaliana] Length = 404 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEKVLLAH 241 DP++AH W NLAN+Y+++GDHR S KCLEKVLLAH Sbjct: 350 DPKSAHAWVNLANSYYMMGDHRSSSKCLEKVLLAH 384 >gb|EYU22249.1| hypothetical protein MIMGU_mgv1a0049472mg, partial [Mimulus guttatus] Length = 385 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DPRAAHIW NLANAY+L+GDHR SGKCLEK Sbjct: 349 DPRAAHIWTNLANAYYLVGDHRTSGKCLEK 378 >gb|EXB90594.1| Tetratricopeptide repeat protein 37 [Morus notabilis] Length = 716 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DPRAAH+WANLANAY+LIGDHR S KCLEK Sbjct: 323 DPRAAHLWANLANAYYLIGDHRSSSKCLEK 352 >ref|XP_006476944.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit-like isoform X3 [Citrus sinensis] Length = 656 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+AAHIWANLANAY+L GDHR SGKCLEK Sbjct: 359 DPKAAHIWANLANAYYLTGDHRSSGKCLEK 388 >ref|XP_006476942.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit-like isoform X1 [Citrus sinensis] gi|568846196|ref|XP_006476943.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit-like isoform X2 [Citrus sinensis] Length = 662 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+AAHIWANLANAY+L GDHR SGKCLEK Sbjct: 365 DPKAAHIWANLANAYYLTGDHRSSGKCLEK 394 >ref|XP_006440000.1| hypothetical protein CICLE_v10019194mg [Citrus clementina] gi|557542262|gb|ESR53240.1| hypothetical protein CICLE_v10019194mg [Citrus clementina] Length = 658 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+AAHIWANLANAY+L GDHR SGKCLEK Sbjct: 361 DPKAAHIWANLANAYYLTGDHRSSGKCLEK 390 >ref|XP_006439999.1| hypothetical protein CICLE_v10019194mg [Citrus clementina] gi|557542261|gb|ESR53239.1| hypothetical protein CICLE_v10019194mg [Citrus clementina] Length = 664 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+AAHIWANLANAY+L GDHR SGKCLEK Sbjct: 367 DPKAAHIWANLANAYYLTGDHRSSGKCLEK 396 >gb|EPS73253.1| hypothetical protein M569_01502 [Genlisea aurea] Length = 643 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DPR++HIW NLANAY LIGDH+ SGKCLEK Sbjct: 356 DPRSSHIWTNLANAYFLIGDHKISGKCLEK 385 >ref|XP_007210884.1| hypothetical protein PRUPE_ppa002631mg [Prunus persica] gi|462406619|gb|EMJ12083.1| hypothetical protein PRUPE_ppa002631mg [Prunus persica] Length = 650 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+AAHIWANLANAY + GDHR S KCLEK Sbjct: 352 DPKAAHIWANLANAYSITGDHRSSSKCLEK 381 >ref|XP_007037847.1| Tetratricopeptide repeat (TPR)-containing protein [Theobroma cacao] gi|508775092|gb|EOY22348.1| Tetratricopeptide repeat (TPR)-containing protein [Theobroma cacao] Length = 653 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+AAH WANLANAY+LIGD+R S KCLEK Sbjct: 356 DPKAAHTWANLANAYYLIGDYRSSSKCLEK 385 >ref|XP_004299179.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Fragaria vesca subsp. vesca] Length = 607 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+A HIWANLANAY++ GDHR S KCLEK Sbjct: 322 DPKAGHIWANLANAYYMTGDHRSSSKCLEK 351 >ref|XP_002318101.2| tetratricopeptide repeat-containing family protein [Populus trichocarpa] gi|550326736|gb|EEE96321.2| tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 665 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 +P+AAHIWANLANAY +IGDHR + KCLEK Sbjct: 368 EPKAAHIWANLANAYFMIGDHRSASKCLEK 397 >ref|XP_002511271.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223550386|gb|EEF51873.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Length = 650 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+AAH+WANLANAY+L GD+R S KCLEK Sbjct: 361 DPKAAHLWANLANAYYLTGDYRSSSKCLEK 390 >ref|XP_006281757.1| hypothetical protein CARUB_v10027919mg [Capsella rubella] gi|482550461|gb|EOA14655.1| hypothetical protein CARUB_v10027919mg [Capsella rubella] Length = 545 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP++AH W NLAN+YH++GDHR S KCLEK Sbjct: 246 DPKSAHTWVNLANSYHMMGDHRSSSKCLEK 275 >ref|XP_006347418.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like isoform X2 [Solanum tuberosum] Length = 657 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 D +AAHIW NLANAY+L+GDHR S KCLEK Sbjct: 366 DSKAAHIWTNLANAYYLMGDHRSSAKCLEK 395 >ref|XP_006347417.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like isoform X1 [Solanum tuberosum] Length = 659 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 D +AAHIW NLANAY+L+GDHR S KCLEK Sbjct: 368 DSKAAHIWTNLANAYYLMGDHRSSAKCLEK 397 >ref|XP_004241497.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Solanum lycopersicum] Length = 663 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 D +AAHIW NLANAY+L+GDHR S KCLEK Sbjct: 366 DSKAAHIWTNLANAYYLMGDHRSSAKCLEK 395 >ref|XP_004152504.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Cucumis sativus] Length = 647 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 345 DPRAAHIWANLANAYHLIGDHRHSGKCLEK 256 DP+AAH WANLANAY + GDHR S KCLEK Sbjct: 350 DPKAAHAWANLANAYFVTGDHRSSAKCLEK 379