BLASTX nr result
ID: Mentha23_contig00007052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00007052 (470 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35037.1| hypothetical protein MIMGU_mgv1a000315mg [Mimulus... 65 7e-09 gb|EPS63633.1| hypothetical protein M569_11150 [Genlisea aurea] 60 4e-07 ref|XP_002527826.1| tip120, putative [Ricinus communis] gi|22353... 59 7e-07 ref|XP_007220298.1| hypothetical protein PRUPE_ppa000384mg [Prun... 56 5e-06 ref|XP_004172325.1| PREDICTED: cullin-associated NEDD8-dissociat... 55 8e-06 ref|XP_004133735.1| PREDICTED: cullin-associated NEDD8-dissociat... 55 8e-06 >gb|EYU35037.1| hypothetical protein MIMGU_mgv1a000315mg [Mimulus guttatus] Length = 1264 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 468 ISGGDCSHKFKNLMTEIAKSSTLSEKYSSIRNE 370 ISGGDCSHKFKNLM+EIAKS TLSEKYSSIRNE Sbjct: 1232 ISGGDCSHKFKNLMSEIAKSHTLSEKYSSIRNE 1264 >gb|EPS63633.1| hypothetical protein M569_11150 [Genlisea aurea] Length = 1222 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 468 ISGGDCSHKFKNLMTEIAKSSTLSEKYSSIRNE 370 ISGG+CSHK KNLM EIAKS LSEKYSSIRNE Sbjct: 1190 ISGGECSHKLKNLMNEIAKSQALSEKYSSIRNE 1222 >ref|XP_002527826.1| tip120, putative [Ricinus communis] gi|223532750|gb|EEF34529.1| tip120, putative [Ricinus communis] Length = 1218 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 468 ISGGDCSHKFKNLMTEIAKSSTLSEKYSSIRNE 370 ISGGDCSHKFKNLM EI+KS TL EKY SIRNE Sbjct: 1186 ISGGDCSHKFKNLMNEISKSPTLWEKYYSIRNE 1218 >ref|XP_007220298.1| hypothetical protein PRUPE_ppa000384mg [Prunus persica] gi|462416760|gb|EMJ21497.1| hypothetical protein PRUPE_ppa000384mg [Prunus persica] Length = 1222 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 468 ISGGDCSHKFKNLMTEIAKSSTLSEKYSSIRNE 370 ISGGDCS KFKNLM EI+KS TLS+KY SIRNE Sbjct: 1190 ISGGDCSLKFKNLMNEISKSPTLSDKYYSIRNE 1222 >ref|XP_004172325.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like, partial [Cucumis sativus] Length = 390 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 468 ISGGDCSHKFKNLMTEIAKSSTLSEKYSSIRNE 370 ISGGDCS KFKNLM EI+KS LSEKY SIRNE Sbjct: 358 ISGGDCSLKFKNLMNEISKSPALSEKYYSIRNE 390 >ref|XP_004133735.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Cucumis sativus] Length = 1218 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 468 ISGGDCSHKFKNLMTEIAKSSTLSEKYSSIRNE 370 ISGGDCS KFKNLM EI+KS LSEKY SIRNE Sbjct: 1186 ISGGDCSLKFKNLMNEISKSPALSEKYYSIRNE 1218