BLASTX nr result
ID: Mentha23_contig00004940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00004940 (1118 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015333.1| Chloroplastic NIFS-like cysteine desulfurase... 66 5e-09 ref|XP_002267920.1| PREDICTED: cysteine desulfurase 2, chloropla... 64 1e-08 ref|XP_002314018.1| cysteine desulfurase family protein [Populus... 64 2e-08 ref|XP_004140178.1| PREDICTED: cysteine desulfurase 2, chloropla... 63 2e-08 ref|XP_006345890.1| PREDICTED: cysteine desulfurase 2, chloropla... 63 2e-08 gb|ABK25420.1| unknown [Picea sitchensis] 62 5e-08 ref|XP_004239746.1| PREDICTED: cysteine desulfurase 2, chloropla... 62 5e-08 ref|XP_002523229.1| cysteine desulfurylase, putative [Ricinus co... 62 5e-08 ref|XP_006417682.1| hypothetical protein EUTSA_v10007548mg [Eutr... 62 5e-08 ref|XP_006470504.1| PREDICTED: cysteine desulfurase 2, chloropla... 61 6e-08 ref|XP_006446358.1| hypothetical protein CICLE_v10015188mg [Citr... 61 6e-08 ref|XP_004502227.1| PREDICTED: cysteine desulfurase 2, chloropla... 61 8e-08 ref|XP_004308190.1| PREDICTED: cysteine desulfurase 2, chloropla... 61 8e-08 ref|XP_007227484.1| hypothetical protein PRUPE_ppa005298mg [Prun... 62 1e-07 ref|XP_006304860.1| hypothetical protein CARUB_v10012604mg [Caps... 61 1e-07 ref|XP_002892460.1| hypothetical protein ARALYDRAFT_470910 [Arab... 61 1e-07 ref|WP_009343202.1| cysteine desulfurase [Raphidiopsis brookii] ... 62 1e-07 gb|EXC09684.1| Cysteine desulfurase 2 [Morus notabilis] 61 1e-07 ref|XP_006663953.1| PREDICTED: cysteine desulfurase 2, chloropla... 61 1e-07 ref|WP_006194433.1| cysteine desulfurase [Nodularia spumigena] g... 59 1e-07 >ref|XP_007015333.1| Chloroplastic NIFS-like cysteine desulfurase isoform 1 [Theobroma cacao] gi|508785696|gb|EOY32952.1| Chloroplastic NIFS-like cysteine desulfurase isoform 1 [Theobroma cacao] Length = 463 Score = 66.2 bits (160), Expect(2) = 5e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQKIH+ E+EL NYLYD+L SV I++YGP+P Sbjct: 336 GAAIDYLSGIGMQKIHDYEMELANYLYDKLCSVPNIRIYGPKP 378 Score = 22.3 bits (46), Expect(2) = 5e-09 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTD+A LDQ Sbjct: 396 HPTDLATFLDQ 406 >ref|XP_002267920.1| PREDICTED: cysteine desulfurase 2, chloroplastic [Vitis vinifera] gi|296083920|emb|CBI24308.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 64.3 bits (155), Expect(2) = 1e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQKIH+ EV+L NYLY+ LRSV + VYGP P Sbjct: 336 GAAIDYLSAIGMQKIHDYEVDLANYLYESLRSVPGVHVYGPAP 378 Score = 23.1 bits (48), Expect(2) = 1e-08 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTDIA LDQ Sbjct: 396 HPTDIATFLDQ 406 >ref|XP_002314018.1| cysteine desulfurase family protein [Populus trichocarpa] gi|222850426|gb|EEE87973.1| cysteine desulfurase family protein [Populus trichocarpa] Length = 469 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYL IGMQKIHE E+EL NYLY+ L +V I++YGP+P Sbjct: 342 GAAIDYLQGIGMQKIHEYEMELANYLYENLSTVPNIRIYGPKP 384 Score = 23.1 bits (48), Expect(2) = 2e-08 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 940 SKSTARDLKIAMRAALAHPTDIAPILDQ 857 SK R + HPTD+A LDQ Sbjct: 385 SKGVNRAALCSFNVKNIHPTDLATFLDQ 412 >ref|XP_004140178.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cucumis sativus] gi|449481029|ref|XP_004156061.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cucumis sativus] Length = 485 Score = 63.2 bits (152), Expect(2) = 2e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQKIH E EL NYLY+ LR+V I++YGP P Sbjct: 358 GAAIDYLSGIGMQKIHSYEEELANYLYENLRAVPNIRIYGPAP 400 Score = 23.1 bits (48), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTDIA LDQ Sbjct: 418 HPTDIATFLDQ 428 >ref|XP_006345890.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Solanum tuberosum] Length = 476 Score = 62.8 bits (151), Expect(2) = 2e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQ+IH+ E+EL NYLYD+L SV +++YGP P Sbjct: 349 GAAIDYLSEIGMQQIHDYEMELGNYLYDRLSSVSDVRIYGPAP 391 Score = 23.5 bits (49), Expect(2) = 2e-08 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 940 SKSTARDLKIAMRAALAHPTDIAPILDQ 857 S++ R + HPTDIA LDQ Sbjct: 392 SRTVKRAALCSFNVKDVHPTDIATFLDQ 419 >gb|ABK25420.1| unknown [Picea sitchensis] Length = 485 Score = 62.0 bits (149), Expect(2) = 5e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQ+IHE E+EL NYLY L +V +++YGP P Sbjct: 358 GAAIDYLSGIGMQRIHEYELELANYLYQSLSNVSNVRIYGPAP 400 Score = 23.1 bits (48), Expect(2) = 5e-08 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTDIA LDQ Sbjct: 418 HPTDIATFLDQ 428 >ref|XP_004239746.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Solanum lycopersicum] Length = 477 Score = 62.0 bits (149), Expect(2) = 5e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DY+S IGMQ+IH+ E+EL NYLYD+L SV +++YGP P Sbjct: 350 GAAIDYISEIGMQQIHDYEMELGNYLYDRLSSVSDVRIYGPAP 392 Score = 23.1 bits (48), Expect(2) = 5e-08 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTDIA LDQ Sbjct: 410 HPTDIATFLDQ 420 >ref|XP_002523229.1| cysteine desulfurylase, putative [Ricinus communis] gi|223537525|gb|EEF39150.1| cysteine desulfurylase, putative [Ricinus communis] Length = 469 Score = 62.0 bits (149), Expect(2) = 5e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYL IGMQKIH+ E+EL NYLY+ L SV +++YGP+P Sbjct: 342 GAAIDYLLGIGMQKIHDYEMELANYLYESLSSVPSVRIYGPKP 384 Score = 23.1 bits (48), Expect(2) = 5e-08 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTDIA LDQ Sbjct: 402 HPTDIATFLDQ 412 >ref|XP_006417682.1| hypothetical protein EUTSA_v10007548mg [Eutrema salsugineum] gi|557095453|gb|ESQ36035.1| hypothetical protein EUTSA_v10007548mg [Eutrema salsugineum] Length = 468 Score = 61.6 bits (148), Expect(2) = 5e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGM KIHE EVEL+ YLY++L S+ +++YGPRP Sbjct: 341 GAACDYLSGIGMPKIHEYEVELSKYLYEKLSSLPDVRIYGPRP 383 Score = 23.5 bits (49), Expect(2) = 5e-08 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 940 SKSTARDLKIAMRAALAHPTDIAPILDQ 857 S+S R + HPTD+A LDQ Sbjct: 384 SESVCRAALCSFNVEGLHPTDLATFLDQ 411 >ref|XP_006470504.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Citrus sinensis] Length = 458 Score = 60.8 bits (146), Expect(2) = 6e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQKIH E+EL YLY+ L S+ I++YGP+P Sbjct: 331 GAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKP 373 Score = 23.9 bits (50), Expect(2) = 6e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTDIA +LDQ Sbjct: 391 HPTDIATLLDQ 401 >ref|XP_006446358.1| hypothetical protein CICLE_v10015188mg [Citrus clementina] gi|557548969|gb|ESR59598.1| hypothetical protein CICLE_v10015188mg [Citrus clementina] Length = 458 Score = 60.8 bits (146), Expect(2) = 6e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQKIH E+EL YLY+ L S+ I++YGP+P Sbjct: 331 GAAIDYLSTIGMQKIHAYEMELAKYLYENLLSIPNIRIYGPKP 373 Score = 23.9 bits (50), Expect(2) = 6e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTDIA +LDQ Sbjct: 391 HPTDIATLLDQ 401 >ref|XP_004502227.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cicer arietinum] Length = 471 Score = 60.8 bits (146), Expect(2) = 8e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQ IHE EVEL YLY++L SV I++YGP P Sbjct: 344 GAAIDYLSGIGMQAIHEYEVELGTYLYERLLSVPNIRIYGPAP 386 Score = 23.5 bits (49), Expect(2) = 8e-08 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 940 SKSTARDLKIAMRAALAHPTDIAPILDQ 857 SK R + HPTD+A LDQ Sbjct: 387 SKEVKRAALCSFNVENLHPTDLATFLDQ 414 >ref|XP_004308190.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 398 Score = 61.2 bits (147), Expect(2) = 8e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGMQKIHE E+EL YLYD L ++ I +YGP P Sbjct: 271 GAAVDYLSGIGMQKIHEYEIELAKYLYDSLCTIPNIHIYGPVP 313 Score = 23.1 bits (48), Expect(2) = 8e-08 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTD+A +LDQ Sbjct: 331 HPTDLATLLDQ 341 >ref|XP_007227484.1| hypothetical protein PRUPE_ppa005298mg [Prunus persica] gi|462424420|gb|EMJ28683.1| hypothetical protein PRUPE_ppa005298mg [Prunus persica] Length = 468 Score = 62.0 bits (149), Expect(2) = 1e-07 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRPKN 912 GAA DYLS +GMQKIH+ E+ L YLYD L SV I +YGP P N Sbjct: 341 GAAIDYLSGLGMQKIHDYEIFLAKYLYDSLSSVPNIHIYGPAPSN 385 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTD+A LDQ Sbjct: 401 HPTDLATYLDQ 411 >ref|XP_006304860.1| hypothetical protein CARUB_v10012604mg [Capsella rubella] gi|482573571|gb|EOA37758.1| hypothetical protein CARUB_v10012604mg [Capsella rubella] Length = 466 Score = 60.8 bits (146), Expect(2) = 1e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGM KIHE EVEL YLY++L S+ +++YGPRP Sbjct: 339 GAAVDYLSEIGMPKIHEYEVELGKYLYEKLSSLPDVRIYGPRP 381 Score = 23.1 bits (48), Expect(2) = 1e-07 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 940 SKSTARDLKIAMRAALAHPTDIAPILDQ 857 S+S R + HPTD+A LDQ Sbjct: 382 SESVHRGALCSFNVEGLHPTDLATFLDQ 409 >ref|XP_002892460.1| hypothetical protein ARALYDRAFT_470910 [Arabidopsis lyrata subsp. lyrata] gi|297338302|gb|EFH68719.1| hypothetical protein ARALYDRAFT_470910 [Arabidopsis lyrata subsp. lyrata] Length = 466 Score = 60.8 bits (146), Expect(2) = 1e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS IGM KIHE EVEL YLY++L S+ +++YGPRP Sbjct: 339 GAAVDYLSGIGMPKIHEYEVELGKYLYEKLSSLPDVRIYGPRP 381 Score = 23.1 bits (48), Expect(2) = 1e-07 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 940 SKSTARDLKIAMRAALAHPTDIAPILDQ 857 S+S R + HPTD+A LDQ Sbjct: 382 SESVHRGALCSFNVEGLHPTDLATFLDQ 409 >ref|WP_009343202.1| cysteine desulfurase [Raphidiopsis brookii] gi|281197810|gb|EFA72704.1| Cysteine desulphurases, SufS [Raphidiopsis brookii D9] Length = 421 Score = 61.6 bits (148), Expect(2) = 1e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYL+NIGM KIH E ELT+YL+DQL + ++ +YGP+P Sbjct: 292 GAAIDYLTNIGMDKIHAYEAELTSYLFDQLAQIPQLTIYGPKP 334 Score = 22.3 bits (46), Expect(2) = 1e-07 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 7/23 (30%) Frame = -2 Query: 904 RAALA-------HPTDIAPILDQ 857 RAALA HP D+A +LDQ Sbjct: 341 RAALASFVANGIHPNDLATLLDQ 363 >gb|EXC09684.1| Cysteine desulfurase 2 [Morus notabilis] Length = 401 Score = 60.8 bits (146), Expect(2) = 1e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLS I MQ+IH+ EV+L NYLY+ LRSV +++YGP P Sbjct: 274 GAAIDYLSAISMQRIHDYEVDLANYLYESLRSVPNVRIYGPVP 316 Score = 23.1 bits (48), Expect(2) = 1e-07 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 889 HPTDIAPILDQ 857 HPTDIA LDQ Sbjct: 334 HPTDIATFLDQ 344 >ref|XP_006663953.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Oryza brachyantha] Length = 375 Score = 61.2 bits (147), Expect(2) = 1e-07 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRPKNCD 906 GAA DYLS IGMQKIHE E EL YLY+ L SV +++YGP P D Sbjct: 248 GAAIDYLSQIGMQKIHEYEKELATYLYESLISVPNVRIYGPAPCQTD 294 Score = 22.7 bits (47), Expect(2) = 1e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 889 HPTDIAPILD 860 HPTDIA ILD Sbjct: 308 HPTDIAEILD 317 >ref|WP_006194433.1| cysteine desulfurase [Nodularia spumigena] gi|119466327|gb|EAW47213.1| hypothetical protein N9414_05150 [Nodularia spumigena CCY9414] gi|585119430|gb|AHJ26372.1| Cysteine desulfurase, SufS subfamily [Nodularia spumigena CCY9414] Length = 420 Score = 59.3 bits (142), Expect(2) = 1e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -1 Query: 1046 GAAFDYLSNIGMQKIHEDEVELTNYLYDQLRSVLRIQVYGPRP 918 GAA DYLSNIGM KIH E ELT YL+ QL + +I +YGP+P Sbjct: 292 GAAVDYLSNIGMDKIHVYEAELTAYLFQQLAQIPQITIYGPKP 334 Score = 24.3 bits (51), Expect(2) = 1e-07 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 940 SKSTARDLKIAMRAALAHPTDIAPILDQ 857 +K R A AA HP D++ +LDQ Sbjct: 336 AKGEGRAALAAFTAADVHPNDLSTLLDQ 363