BLASTX nr result
ID: Mentha23_contig00004810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00004810 (614 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] 111 1e-22 ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prun... 111 2e-22 ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutr... 105 1e-20 gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulu... 103 3e-20 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 103 3e-20 ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [F... 102 7e-20 ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana... 102 9e-20 gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] ... 102 1e-19 ref|XP_002884539.1| low temperature and salt responsive protein ... 102 1e-19 ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatu... 101 2e-19 gb|EYU35366.1| hypothetical protein MIMGU_mgv1a017610mg [Mimulus... 100 3e-19 gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] 100 3e-19 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 100 3e-19 ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Caps... 100 3e-19 ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatu... 100 3e-19 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 100 3e-19 gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago tru... 100 3e-19 ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prun... 100 4e-19 ref|XP_002884538.1| predicted protein [Arabidopsis lyrata subsp.... 100 4e-19 ref|NP_001232820.1| hydrophobic protein LTI6A [Zea mays] gi|1956... 100 4e-19 >gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 111 bits (278), Expect = 1e-22 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 MGTATFIDII+AILLPPLGVFLKFGCGAEFWICL+LTLFGY+PGIIYAIYIITK Sbjct: 1 MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILTLFGYIPGIIYAIYIITK 54 >ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] gi|462401825|gb|EMJ07382.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 111 bits (277), Expect = 2e-22 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = -2 Query: 598 QREVEMGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 Q + MGTATF+DII+AILLPPLGVFLKFGC AEFWICL+LTLFGYLPGIIYAIYI+TK Sbjct: 35 QNSIRMGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 93 >ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] gi|557109162|gb|ESQ49469.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] Length = 54 Score = 105 bits (261), Expect = 1e-20 Identities = 45/54 (83%), Positives = 53/54 (98%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 MGTATFIDI++AILLPPLGVFL+FGCG EFWICL+LTLFGYLPGI+YA+Y++TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRFGCGVEFWICLVLTLFGYLPGILYALYVLTK 54 >gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulus guttatus] Length = 54 Score = 103 bits (258), Expect = 3e-20 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 MG+ATF+DIIVAILLPPLGVFLKFGC EFWICL+LTLFGYLPGIIYAIY ITK Sbjct: 1 MGSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAIYAITK 54 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 103 bits (258), Expect = 3e-20 Identities = 47/61 (77%), Positives = 55/61 (90%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK*GSFFM 404 M TATF++II+AI+LPPLGVFLKFGC EFWICL+LTLFGYLPGI+YA+YIITK S F+ Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKKNSCFV 60 Query: 403 V 401 V Sbjct: 61 V 61 >ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. vesca] Length = 57 Score = 102 bits (255), Expect = 7e-20 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -2 Query: 580 GTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 GTA FIDII+AILLPPLGVFLKFGC EFWICLLLT+FGY+PGIIYAIY+ITK Sbjct: 5 GTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIYVITK 57 >ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] gi|15214251|sp|Q9ZNQ7.1|RCI2A_ARATH RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A gi|6714401|gb|AAF26090.1|AC012393_16 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|13957674|gb|AAK50619.1|AF264749_2 hydrophobic protein RCI2A [Arabidopsis thaliana] gi|4039153|gb|AAC97512.1| low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|4325217|gb|AAD17302.1| hydrophobic protein [Arabidopsis thaliana] gi|14335130|gb|AAK59845.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|14532470|gb|AAK63963.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|18655345|gb|AAL76128.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|332640790|gb|AEE74311.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] Length = 54 Score = 102 bits (254), Expect = 9e-20 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 M TATF+DII+AILLPPLGVFL+FGCG EFWICL+LTL GY+PGIIYAIY++TK Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] gi|388893090|gb|AFK81275.1| rare cold-inducible protein 2A [Camelina sativa] Length = 54 Score = 102 bits (253), Expect = 1e-19 Identities = 43/54 (79%), Positives = 51/54 (94%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 M TATF+DII+A+LLPPLGVFL+FGCG EFWICL+LTL GY+PGIIYAIY++TK Sbjct: 1 MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 102 bits (253), Expect = 1e-19 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK*GSFFM 404 M TATF++II+AI+LPPLGVFLKFGC EFWICL+LTLFGYLPGI+YA+YIITK F+ Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKRNRCFV 60 Query: 403 V 401 V Sbjct: 61 V 61 >ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatula] gi|87241331|gb|ABD33189.1| Protein of unknown function UPF0057; Bacterial extracellular solute-binding protein, family 3 [Medicago truncatula] gi|355501146|gb|AES82349.1| Hydrophobic protein RCI2B [Medicago truncatula] Length = 54 Score = 101 bits (251), Expect = 2e-19 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 MGTATF+DII++ILLPPLGVFLKFG EFWICL+LTLFGYLPGIIYAIYIITK Sbjct: 1 MGTATFVDIILSILLPPLGVFLKFGLEVEFWICLVLTLFGYLPGIIYAIYIITK 54 >gb|EYU35366.1| hypothetical protein MIMGU_mgv1a017610mg [Mimulus guttatus] Length = 56 Score = 100 bits (249), Expect = 3e-19 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -2 Query: 577 TATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 TATFIDI+VAI+LPPLGVFL+FGCG EFWICL+LTLFGY+PGIIYA+Y ITK Sbjct: 5 TATFIDILVAIILPPLGVFLRFGCGIEFWICLILTLFGYVPGIIYAVYAITK 56 >gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] Length = 57 Score = 100 bits (249), Expect = 3e-19 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -2 Query: 580 GTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 G+AT +DI++AI+LPPLGVFLKFGC AEFWICLLLTLFGYLPGIIYA+YIITK Sbjct: 5 GSATCVDILLAIILPPLGVFLKFGCRAEFWICLLLTLFGYLPGIIYAVYIITK 57 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 100 bits (249), Expect = 3e-19 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 M TATF++II+AI+LPPLGVFLKFGC EFWICL+LTLFGYLPGI+YA+YIITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] gi|482567642|gb|EOA31831.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] Length = 54 Score = 100 bits (249), Expect = 3e-19 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 M TATF++I++AILLPPLGVFLKFGC EFWICL+LTLFGYLPGI+YA+YIITK Sbjct: 1 MSTATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatula] gi|355501150|gb|AES82353.1| Hydrophobic protein LTI6B [Medicago truncatula] Length = 83 Score = 100 bits (249), Expect = 3e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 MGTAT IDIIVAI+LPPLGVFLKFGC EFW+CL+LTLFGYLPGI+YAIY ITK Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITK 54 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 100 bits (249), Expect = 3e-19 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 M TATF++II+AI+LPPLGVFLKFGC EFWICL+LTLFGYLPGI+YA+YIITK Sbjct: 673 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 726 >gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago truncatula] Length = 54 Score = 100 bits (249), Expect = 3e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 MGTAT IDIIVAI+LPPLGVFLKFGC EFW+CL+LTLFGYLPGI+YAIY ITK Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITK 54 >ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] gi|462403051|gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] Length = 57 Score = 100 bits (248), Expect = 4e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 580 GTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 GTA FIDI++AILLPPLGVFLKFGC EFWICLLLT+FGY+PGIIYA+Y ITK Sbjct: 5 GTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAVYAITK 57 >ref|XP_002884538.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330378|gb|EFH60797.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 100 bits (248), Expect = 4e-19 Identities = 42/54 (77%), Positives = 51/54 (94%) Frame = -2 Query: 583 MGTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 MGTAT +DII+AILLPPLGVFL+FGCG EFWICL+LTL GY+PGI+YA+Y++TK Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGILYALYVLTK 54 >ref|NP_001232820.1| hydrophobic protein LTI6A [Zea mays] gi|195618322|gb|ACG30991.1| hydrophobic protein LTI6A [Zea mays] Length = 56 Score = 100 bits (248), Expect = 4e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 580 GTATFIDIIVAILLPPLGVFLKFGCGAEFWICLLLTLFGYLPGIIYAIYIITK 422 GTATFIDII+AI+LPPLGVF KFGCG EFWICL+LT FGYLPGIIYA++ ITK Sbjct: 4 GTATFIDIILAIILPPLGVFFKFGCGVEFWICLILTFFGYLPGIIYAVWAITK 56