BLASTX nr result
ID: Mentha23_contig00004767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00004767 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC23291.1| 60S ribosomal protein L19-2 [Morus notabilis] 64 2e-08 ref|XP_006654105.1| PREDICTED: 60S ribosomal protein L19-1-like ... 64 2e-08 ref|XP_006650058.1| PREDICTED: 60S ribosomal protein L19-1-like ... 64 2e-08 ref|XP_007051011.1| Ribosomal protein L19e family protein [Theob... 64 2e-08 ref|XP_002318334.1| 60S ribosomal protein L19-1 [Populus trichoc... 64 2e-08 ref|XP_006374263.1| hypothetical protein POPTR_0015s05500g [Popu... 64 2e-08 gb|EXB95736.1| 60S ribosomal protein L19-2 [Morus notabilis] 63 5e-08 ref|XP_006480007.1| PREDICTED: 60S ribosomal protein L19-2-like ... 63 5e-08 ref|XP_007163146.1| hypothetical protein PHAVU_001G210100g [Phas... 63 5e-08 ref|XP_006444411.1| hypothetical protein CICLE_v10022255mg [Citr... 63 5e-08 ref|XP_006419496.1| hypothetical protein CICLE_v10005909mg [Citr... 63 5e-08 ref|XP_006419495.1| hypothetical protein CICLE_v10005909mg [Citr... 63 5e-08 ref|XP_004489107.1| PREDICTED: 60S ribosomal protein L19-1-like ... 63 5e-08 gb|AFK37588.1| unknown [Lotus japonicus] 63 5e-08 ref|NP_001241295.1| uncharacterized protein LOC100818880 [Glycin... 63 5e-08 ref|NP_001237389.1| uncharacterized protein LOC100527275 [Glycin... 63 5e-08 ref|NP_001050051.1| Os03g0337800 [Oryza sativa Japonica Group] g... 63 5e-08 gb|AAT08672.1| ribosomal protein L19 [Hyacinthus orientalis] 63 5e-08 emb|CBN76992.1| conserved unknown protein [Ectocarpus siliculosus] 62 6e-08 gb|EMT16977.1| 60S ribosomal protein L19-2 [Aegilops tauschii] 62 1e-07 >gb|EXC23291.1| 60S ribosomal protein L19-2 [Morus notabilis] Length = 206 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 30 >ref|XP_006654105.1| PREDICTED: 60S ribosomal protein L19-1-like [Oryza brachyantha] Length = 209 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 30 >ref|XP_006650058.1| PREDICTED: 60S ribosomal protein L19-1-like [Oryza brachyantha] Length = 209 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 30 >ref|XP_007051011.1| Ribosomal protein L19e family protein [Theobroma cacao] gi|508703272|gb|EOX95168.1| Ribosomal protein L19e family protein [Theobroma cacao] Length = 210 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 30 >ref|XP_002318334.1| 60S ribosomal protein L19-1 [Populus trichocarpa] gi|222859007|gb|EEE96554.1| 60S ribosomal protein L19-1 [Populus trichocarpa] Length = 212 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 30 >ref|XP_006374263.1| hypothetical protein POPTR_0015s05500g [Populus trichocarpa] gi|118483373|gb|ABK93587.1| unknown [Populus trichocarpa] gi|550322020|gb|ERP52060.1| hypothetical protein POPTR_0015s05500g [Populus trichocarpa] Length = 212 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 30 >gb|EXB95736.1| 60S ribosomal protein L19-2 [Morus notabilis] Length = 213 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >ref|XP_006480007.1| PREDICTED: 60S ribosomal protein L19-2-like [Citrus sinensis] Length = 209 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >ref|XP_007163146.1| hypothetical protein PHAVU_001G210100g [Phaseolus vulgaris] gi|561036610|gb|ESW35140.1| hypothetical protein PHAVU_001G210100g [Phaseolus vulgaris] Length = 211 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >ref|XP_006444411.1| hypothetical protein CICLE_v10022255mg [Citrus clementina] gi|557546673|gb|ESR57651.1| hypothetical protein CICLE_v10022255mg [Citrus clementina] Length = 209 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >ref|XP_006419496.1| hypothetical protein CICLE_v10005909mg [Citrus clementina] gi|568871717|ref|XP_006489028.1| PREDICTED: 60S ribosomal protein L19-1-like [Citrus sinensis] gi|557521369|gb|ESR32736.1| hypothetical protein CICLE_v10005909mg [Citrus clementina] Length = 204 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >ref|XP_006419495.1| hypothetical protein CICLE_v10005909mg [Citrus clementina] gi|557521368|gb|ESR32735.1| hypothetical protein CICLE_v10005909mg [Citrus clementina] Length = 197 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >ref|XP_004489107.1| PREDICTED: 60S ribosomal protein L19-1-like [Cicer arietinum] Length = 211 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >gb|AFK37588.1| unknown [Lotus japonicus] Length = 210 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >ref|NP_001241295.1| uncharacterized protein LOC100818880 [Glycine max] gi|255647307|gb|ACU24120.1| unknown [Glycine max] Length = 212 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRL+ASVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLAASVLKCGKGKVWLDPNEVN 30 >ref|NP_001237389.1| uncharacterized protein LOC100527275 [Glycine max] gi|255631934|gb|ACU16334.1| unknown [Glycine max] Length = 212 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRLSASVLKCG+GKVWLDPNEVN Sbjct: 1 MVSLKLQKRLSASVLKCGRGKVWLDPNEVN 30 >ref|NP_001050051.1| Os03g0337800 [Oryza sativa Japonica Group] gi|108708037|gb|ABF95832.1| 60S ribosomal protein L19-1, putative, expressed [Oryza sativa Japonica Group] gi|113548522|dbj|BAF11965.1| Os03g0337800 [Oryza sativa Japonica Group] gi|125543790|gb|EAY89929.1| hypothetical protein OsI_11477 [Oryza sativa Indica Group] gi|125586185|gb|EAZ26849.1| hypothetical protein OsJ_10765 [Oryza sativa Japonica Group] gi|215734967|dbj|BAG95689.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765261|dbj|BAG86958.1| unnamed protein product [Oryza sativa Japonica Group] Length = 208 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRL+ASVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLAASVLKCGKGKVWLDPNEVN 30 >gb|AAT08672.1| ribosomal protein L19 [Hyacinthus orientalis] Length = 203 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MV+LKLQKRLSASVLKCGKGKVWLDPNEVN Sbjct: 1 MVALKLQKRLSASVLKCGKGKVWLDPNEVN 30 >emb|CBN76992.1| conserved unknown protein [Ectocarpus siliculosus] Length = 190 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRL+ASVLKCGKGK+WLDPNEVN Sbjct: 1 MVSLKLQKRLAASVLKCGKGKIWLDPNEVN 30 >gb|EMT16977.1| 60S ribosomal protein L19-2 [Aegilops tauschii] Length = 228 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 243 MVSLKLQKRLSASVLKCGKGKVWLDPNEVN 332 MVSLKLQKRL++SVLKCGKGKVWLDPNEVN Sbjct: 1 MVSLKLQKRLASSVLKCGKGKVWLDPNEVN 30