BLASTX nr result
ID: Mentha23_contig00004691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00004691 (733 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozy... 114 3e-23 gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum] gi|1591... 112 1e-22 gb|ABW89463.1| glutamine synthetase [Gossypium raimondii] 112 1e-22 gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum] 112 1e-22 gb|ABW89461.1| glutamine synthetase [Gossypium hirsutum] 112 1e-22 gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum] gi|159... 112 1e-22 ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prun... 112 2e-22 gb|AAK08103.1|AF338444_1 glutamine synthetase [Avicennia marina] 112 2e-22 ref|XP_003570690.1| PREDICTED: glutamine synthetase cytosolic is... 112 2e-22 ref|XP_006651743.1| PREDICTED: glutamine synthetase cytosolic is... 111 2e-22 gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis] 111 3e-22 gb|AFN42876.1| glutamine synthetase [Camellia sinensis] 111 3e-22 ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like ... 111 3e-22 ref|XP_006482120.1| PREDICTED: glutamine synthetase nodule isozy... 110 4e-22 ref|XP_006430603.1| hypothetical protein CICLE_v10011785mg [Citr... 110 4e-22 ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutr... 110 4e-22 ref|NP_001051067.1| Os03g0712800 [Oryza sativa Japonica Group] g... 110 6e-22 dbj|BAA04996.1| glutamine synthetase [Raphanus sativus] 110 6e-22 dbj|BAA04995.1| glutamine synthetase [Raphanus sativus] 110 6e-22 gb|AFB69879.1| glutamine synthetase isoform 1-1 [Secale cereale] 110 6e-22 >ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme-like [Fragaria vesca subsp. vesca] Length = 356 Score = 114 bits (286), Expect = 3e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDLINLDLS+STDK+IAEY+WIGGSGMDLRSKARTL GPVSDPSKLPKWNYDG Sbjct: 1 MSLLTDLINLDLSDSTDKIIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDG 57 >gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum] gi|159138931|gb|ABW89465.1| glutamine synthetase [Gossypium hirsutum] Length = 356 Score = 112 bits (280), Expect = 1e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDL+NL+LS+ TDK+IAEY+WIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 57 >gb|ABW89463.1| glutamine synthetase [Gossypium raimondii] Length = 356 Score = 112 bits (280), Expect = 1e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDL+NL+LS+ TDK+IAEY+WIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 57 >gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum] Length = 356 Score = 112 bits (280), Expect = 1e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDL+NL+LS+ TDK+IAEY+WIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 57 >gb|ABW89461.1| glutamine synthetase [Gossypium hirsutum] Length = 356 Score = 112 bits (280), Expect = 1e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDL+NL+LS+ TDK+IAEY+WIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 57 >gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum] gi|159138933|gb|ABW89466.1| glutamine synthetase [Gossypium hirsutum] Length = 356 Score = 112 bits (280), Expect = 1e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDL+NL+LS+ TDK+IAEY+WIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 57 >ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica] gi|462411755|gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica] Length = 356 Score = 112 bits (279), Expect = 2e-22 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLL+DLINLDLS+ST+KVIAEY+WIGGSGMDLRSKARTL GPVSDPSKLPKWNYDG Sbjct: 1 MSLLSDLINLDLSDSTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDG 57 >gb|AAK08103.1|AF338444_1 glutamine synthetase [Avicennia marina] Length = 356 Score = 112 bits (279), Expect = 2e-22 Identities = 50/57 (87%), Positives = 57/57 (100%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLL+DL+NLDLSE+T+K+IAEYVW+GGSGMDLRSKART+SGPVSDPSKLPKWNYDG Sbjct: 1 MSLLSDLLNLDLSETTEKIIAEYVWVGGSGMDLRSKARTISGPVSDPSKLPKWNYDG 57 >ref|XP_003570690.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Brachypodium distachyon] Length = 356 Score = 112 bits (279), Expect = 2e-22 Identities = 50/57 (87%), Positives = 57/57 (100%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 M+LLTDL+NLDLS+ST+K+IAEY+WIGGSGMDLRSKARTLSGPV+DPSKLPKWNYDG Sbjct: 1 MALLTDLLNLDLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDG 57 >ref|XP_006651743.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-3-like [Oryza brachyantha] Length = 364 Score = 111 bits (278), Expect = 2e-22 Identities = 49/57 (85%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDL+N+DLSESTDK+IAEYVW+GG+GMD+RSKARTLSGPV DPSKLPKWN+DG Sbjct: 1 MSLLTDLVNIDLSESTDKIIAEYVWVGGTGMDMRSKARTLSGPVDDPSKLPKWNFDG 57 >gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis] Length = 356 Score = 111 bits (277), Expect = 3e-22 Identities = 50/57 (87%), Positives = 57/57 (100%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLL+DLINL+LS++TDK+IAEY+WIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDG Sbjct: 1 MSLLSDLINLNLSDTTDKIIAEYIWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDG 57 >gb|AFN42876.1| glutamine synthetase [Camellia sinensis] Length = 356 Score = 111 bits (277), Expect = 3e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLL+DLINLDLS++T+KVIAEY+WIGGSGMDLRSKARTLSGPVSDP KLPKWNYDG Sbjct: 1 MSLLSDLINLDLSDTTEKVIAEYIWIGGSGMDLRSKARTLSGPVSDPKKLPKWNYDG 57 >ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like [Cucumis sativus] gi|374676432|gb|AEZ56958.1| glutamine synthetase [Cucumis sativus] Length = 356 Score = 111 bits (277), Expect = 3e-22 Identities = 50/57 (87%), Positives = 57/57 (100%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLL+DL+NL+LS+ST+K+IAEY+WIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG Sbjct: 1 MSLLSDLVNLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 57 >ref|XP_006482120.1| PREDICTED: glutamine synthetase nodule isozyme-like [Citrus sinensis] Length = 356 Score = 110 bits (276), Expect = 4e-22 Identities = 50/57 (87%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLL+DL+NL+LSESTDK+IAEY+WIGGSGMD+RSKARTL GPVSDPSKLPKWNYDG Sbjct: 1 MSLLSDLLNLNLSESTDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDG 57 >ref|XP_006430603.1| hypothetical protein CICLE_v10011785mg [Citrus clementina] gi|557532660|gb|ESR43843.1| hypothetical protein CICLE_v10011785mg [Citrus clementina] Length = 429 Score = 110 bits (276), Expect = 4e-22 Identities = 50/57 (87%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLL+DL+NL+LSESTDK+IAEY+WIGGSGMD+RSKARTL GPVSDPSKLPKWNYDG Sbjct: 74 MSLLSDLLNLNLSESTDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDG 130 >ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum] gi|557087798|gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum] Length = 356 Score = 110 bits (276), Expect = 4e-22 Identities = 49/57 (85%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDLINLDLS+ST+K+IAEY+W+GGSGMD+RSKARTL GPV+DPSKLPKWNYDG Sbjct: 1 MSLLTDLINLDLSDSTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDG 57 >ref|NP_001051067.1| Os03g0712800 [Oryza sativa Japonica Group] gi|75317706|sp|Q4W8D0.1|GLN13_ORYSJ RecName: Full=Glutamine synthetase cytosolic isozyme 1-3; AltName: Full=Glutamate--ammonia ligase GLN1;3; Short=OsGLN1;3; AltName: Full=OsGS1;3 gi|13324800|gb|AAK18848.1|AC082645_18 putative glutamine synthetase [Oryza sativa Japonica Group] gi|66912123|dbj|BAD99301.1| cytosolic glutamine synthetase 1;3 [Oryza sativa Japonica Group] gi|108710733|gb|ABF98528.1| Glutamine synthetase root isozyme 2, putative, expressed [Oryza sativa Japonica Group] gi|113549538|dbj|BAF12981.1| Os03g0712800 [Oryza sativa Japonica Group] gi|215686655|dbj|BAG88908.1| unnamed protein product [Oryza sativa Japonica Group] gi|215708776|dbj|BAG94045.1| unnamed protein product [Oryza sativa Japonica Group] gi|222625674|gb|EEE59806.1| hypothetical protein OsJ_12330 [Oryza sativa Japonica Group] Length = 370 Score = 110 bits (274), Expect = 6e-22 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = +3 Query: 564 SLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 SLLTDL+NLDLSESTDKVIAEY+W+GG+GMD+RSKARTLSGPV DPSKLPKWN+DG Sbjct: 4 SLLTDLVNLDLSESTDKVIAEYIWVGGTGMDVRSKARTLSGPVDDPSKLPKWNFDG 59 >dbj|BAA04996.1| glutamine synthetase [Raphanus sativus] Length = 356 Score = 110 bits (274), Expect = 6e-22 Identities = 49/57 (85%), Positives = 56/57 (98%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDLINL+LSE+TDK+IAEY+W+GGSGMD+RSKARTL GPVSDPS+LPKWNYDG Sbjct: 1 MSLLTDLINLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDG 57 >dbj|BAA04995.1| glutamine synthetase [Raphanus sativus] Length = 356 Score = 110 bits (274), Expect = 6e-22 Identities = 48/57 (84%), Positives = 57/57 (100%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 MSLLTDLINLDLS++T+K+IAEY+W+GGSGMD+RSKARTLSGPV+DPS+LPKWNYDG Sbjct: 1 MSLLTDLINLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSQLPKWNYDG 57 >gb|AFB69879.1| glutamine synthetase isoform 1-1 [Secale cereale] Length = 356 Score = 110 bits (274), Expect = 6e-22 Identities = 50/57 (87%), Positives = 55/57 (96%) Frame = +3 Query: 561 MSLLTDLINLDLSESTDKVIAEYVWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG 731 M+LLTDL+NLDLS STDK+IAEY+WIGGSGMDLRSKARTL GPV+DPSKLPKWNYDG Sbjct: 1 MALLTDLLNLDLSGSTDKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57