BLASTX nr result
ID: Mentha23_contig00004354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00004354 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006650508.1| PREDICTED: peptide transporter PTR2-like [Or... 72 8e-11 gb|ABR32183.1| peptide transporter [Hakea actites] 70 3e-10 ref|XP_006346628.1| PREDICTED: peptide transporter PTR2-like [So... 69 5e-10 ref|NP_001051098.1| Os03g0719900 [Oryza sativa Japonica Group] g... 69 7e-10 ref|XP_002315835.1| Peptide transporter PTR2-B family protein [P... 69 7e-10 gb|EEE59822.1| hypothetical protein OsJ_12376 [Oryza sativa Japo... 69 7e-10 gb|AAM47310.1|AF377946_12 putative peptide transporter protein [... 69 7e-10 ref|XP_003560544.1| PREDICTED: peptide transporter PTR2-like [Br... 69 9e-10 ref|XP_006346661.1| PREDICTED: peptide transporter PTR2-like [So... 68 1e-09 ref|XP_006849517.1| hypothetical protein AMTR_s00024p00147790 [A... 67 3e-09 ref|XP_007222295.1| hypothetical protein PRUPE_ppa003339mg [Prun... 67 3e-09 ref|XP_007222294.1| hypothetical protein PRUPE_ppa003339mg [Prun... 67 3e-09 ref|XP_002463973.1| hypothetical protein SORBIDRAFT_01g009900 [S... 67 3e-09 ref|XP_002521890.1| peptide transporter, putative [Ricinus commu... 67 3e-09 ref|XP_006849521.1| hypothetical protein AMTR_s00024p00149600 [A... 66 4e-09 ref|XP_006849520.1| hypothetical protein AMTR_s00024p00148850 [A... 66 4e-09 ref|XP_002463972.1| hypothetical protein SORBIDRAFT_01g009890 [S... 66 4e-09 ref|XP_004252286.1| PREDICTED: peptide transporter PTR2-like [So... 66 6e-09 ref|XP_003561541.1| PREDICTED: peptide transporter PTR1-like [Br... 66 6e-09 ref|XP_006643742.1| PREDICTED: peptide transporter PTR1-like [Or... 65 7e-09 >ref|XP_006650508.1| PREDICTED: peptide transporter PTR2-like [Oryza brachyantha] Length = 595 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LS +NFVIY+FC Sbjct: 553 GWIPDNLNEGHLDYFFWLLAGLSFLNFVIYIFC 585 >gb|ABR32183.1| peptide transporter [Hakea actites] Length = 583 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LS +N VIYVFC Sbjct: 541 GWIPDNLNEGHLDYFFWLLAGLSFLNLVIYVFC 573 >ref|XP_006346628.1| PREDICTED: peptide transporter PTR2-like [Solanum tuberosum] Length = 585 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIP+NLN GHLDYFFWLLAALS NFVIYVFC Sbjct: 543 GWIPNNLNSGHLDYFFWLLAALSFCNFVIYVFC 575 >ref|NP_001051098.1| Os03g0719900 [Oryza sativa Japonica Group] gi|15076661|dbj|BAB62326.1| peptide transporter [Oryza sativa Japonica Group] gi|15076663|dbj|BAB62327.1| peptide transporter [Oryza sativa Japonica Group] gi|50540680|gb|AAT77837.1| putative peptide transporter 1 [Oryza sativa Japonica Group] gi|108710787|gb|ABF98582.1| Peptide transporter PTR2, putative, expressed [Oryza sativa Japonica Group] gi|113549569|dbj|BAF13012.1| Os03g0719900 [Oryza sativa Japonica Group] gi|215704432|dbj|BAG93866.1| unnamed protein product [Oryza sativa Japonica Group] gi|218193658|gb|EEC76085.1| hypothetical protein OsI_13317 [Oryza sativa Indica Group] Length = 593 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLN+GHLDYFFWLLA LS +NFVIYV C Sbjct: 551 GWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVIC 583 >ref|XP_002315835.1| Peptide transporter PTR2-B family protein [Populus trichocarpa] gi|222864875|gb|EEF02006.1| Peptide transporter PTR2-B family protein [Populus trichocarpa] Length = 584 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LS++N ++YVFC Sbjct: 543 GWIPDNLNEGHLDYFFWLLAGLSVLNMLVYVFC 575 >gb|EEE59822.1| hypothetical protein OsJ_12376 [Oryza sativa Japonica Group] Length = 593 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLN+GHLDYFFWLLA LS +NFVIYV C Sbjct: 551 GWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVIC 583 >gb|AAM47310.1|AF377946_12 putative peptide transporter protein [Oryza sativa Japonica Group] Length = 377 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLN+GHLDYFFWLLA LS +NFVIYV C Sbjct: 335 GWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVIC 367 >ref|XP_003560544.1| PREDICTED: peptide transporter PTR2-like [Brachypodium distachyon] Length = 589 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LS +NF++YV C Sbjct: 547 GWIPDNLNEGHLDYFFWLLAGLSFLNFLVYVLC 579 >ref|XP_006346661.1| PREDICTED: peptide transporter PTR2-like [Solanum tuberosum] Length = 766 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIP+NLN GHLDYFFWLLAALS NFVIY+FC Sbjct: 724 GWIPNNLNSGHLDYFFWLLAALSFCNFVIYLFC 756 >ref|XP_006849517.1| hypothetical protein AMTR_s00024p00147790 [Amborella trichopoda] gi|548853092|gb|ERN11098.1| hypothetical protein AMTR_s00024p00147790 [Amborella trichopoda] Length = 589 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LS +N VIYV C Sbjct: 547 GWIPDNLNEGHLDYFFWLLAGLSFLNLVIYVTC 579 >ref|XP_007222295.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica] gi|462419231|gb|EMJ23494.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica] Length = 584 Score = 67.0 bits (162), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LSL+N ++Y+ C Sbjct: 542 GWIPDNLNEGHLDYFFWLLAGLSLLNMLVYIVC 574 >ref|XP_007222294.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica] gi|462419230|gb|EMJ23493.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica] Length = 458 Score = 67.0 bits (162), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LSL+N ++Y+ C Sbjct: 416 GWIPDNLNEGHLDYFFWLLAGLSLLNMLVYIVC 448 >ref|XP_002463973.1| hypothetical protein SORBIDRAFT_01g009900 [Sorghum bicolor] gi|241917827|gb|EER90971.1| hypothetical protein SORBIDRAFT_01g009900 [Sorghum bicolor] Length = 587 Score = 67.0 bits (162), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LS +N ++YV C Sbjct: 545 GWIPDNLNEGHLDYFFWLLAGLSFLNLIVYVIC 577 >ref|XP_002521890.1| peptide transporter, putative [Ricinus communis] gi|223538928|gb|EEF40526.1| peptide transporter, putative [Ricinus communis] Length = 585 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWLLA LS+VN ++Y+ C Sbjct: 543 GWIPDNLNEGHLDYFFWLLAGLSVVNMLLYIVC 575 >ref|XP_006849521.1| hypothetical protein AMTR_s00024p00149600 [Amborella trichopoda] gi|548853096|gb|ERN11102.1| hypothetical protein AMTR_s00024p00149600 [Amborella trichopoda] Length = 574 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHL+YFFWLLA LSL+N V+YV C Sbjct: 532 GWIPDNLNEGHLNYFFWLLAGLSLLNLVVYVAC 564 >ref|XP_006849520.1| hypothetical protein AMTR_s00024p00148850 [Amborella trichopoda] gi|548853095|gb|ERN11101.1| hypothetical protein AMTR_s00024p00148850 [Amborella trichopoda] Length = 589 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIP+NLNEGHLDYFFWLLA LSL+N V+YV C Sbjct: 547 GWIPNNLNEGHLDYFFWLLAGLSLLNLVVYVAC 579 >ref|XP_002463972.1| hypothetical protein SORBIDRAFT_01g009890 [Sorghum bicolor] gi|241917826|gb|EER90970.1| hypothetical protein SORBIDRAFT_01g009890 [Sorghum bicolor] Length = 588 Score = 66.2 bits (160), Expect = 4e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIPDNLNEGHLDYFFWL+A LS +N ++YV C Sbjct: 546 GWIPDNLNEGHLDYFFWLIAGLSFLNLIVYVIC 578 >ref|XP_004252286.1| PREDICTED: peptide transporter PTR2-like [Solanum lycopersicum] Length = 585 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVFC 99 GWIP+NLN GHLDYFFWLLAALS NF++Y FC Sbjct: 543 GWIPNNLNSGHLDYFFWLLAALSFCNFLVYFFC 575 >ref|XP_003561541.1| PREDICTED: peptide transporter PTR1-like [Brachypodium distachyon] Length = 689 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYVF 96 GWIPDNLN+GHLDYFFWLLAALS++NFV+Y++ Sbjct: 633 GWIPDNLNKGHLDYFFWLLAALSVLNFVVYLW 664 >ref|XP_006643742.1| PREDICTED: peptide transporter PTR1-like [Oryza brachyantha] Length = 582 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 GWIPDNLNEGHLDYFFWLLAALSLVNFVIYV 93 GWIPDNLN GHLDYFFWLLA LSL+NFV+Y+ Sbjct: 526 GWIPDNLNRGHLDYFFWLLAVLSLINFVVYL 556