BLASTX nr result
ID: Mentha23_contig00004047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00004047 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31780.1| hypothetical protein MIMGU_mgv1a014282mg [Mimulus... 74 3e-11 ref|XP_006850855.1| hypothetical protein AMTR_s00025p00141470 [A... 72 8e-11 ref|XP_006473978.1| PREDICTED: trafficking protein particle comp... 72 1e-10 ref|XP_006453660.1| hypothetical protein CICLE_v10009392mg [Citr... 72 1e-10 ref|XP_006453659.1| hypothetical protein CICLE_v10009392mg [Citr... 72 1e-10 ref|XP_007011967.1| Transport protein particle (TRAPP) component... 72 1e-10 ref|XP_007204907.1| hypothetical protein PRUPE_ppa011818mg [Prun... 72 1e-10 ref|XP_002523497.1| Transport protein particle subunit trs31, pu... 72 1e-10 ref|XP_002279200.1| PREDICTED: trafficking protein particle comp... 72 1e-10 ref|XP_004510694.1| PREDICTED: trafficking protein particle comp... 71 1e-10 ref|XP_006590273.1| PREDICTED: uncharacterized protein LOC100527... 71 2e-10 ref|XP_007163507.1| hypothetical protein PHAVU_001G239800g [Phas... 71 2e-10 ref|XP_007163506.1| hypothetical protein PHAVU_001G239800g [Phas... 71 2e-10 ref|NP_001237223.1| uncharacterized protein LOC100527008 [Glycin... 71 2e-10 gb|EMT00646.1| hypothetical protein F775_28372 [Aegilops tauschii] 70 2e-10 ref|XP_004140592.1| PREDICTED: trafficking protein particle comp... 70 3e-10 ref|XP_002308390.1| transport protein particle component Bet3 [P... 70 3e-10 gb|EPS63030.1| hypothetical protein M569_11758, partial [Genlise... 70 4e-10 gb|AFK42122.1| unknown [Lotus japonicus] 70 4e-10 ref|NP_001237511.1| uncharacterized protein LOC100500147 [Glycin... 70 4e-10 >gb|EYU31780.1| hypothetical protein MIMGU_mgv1a014282mg [Mimulus guttatus] Length = 194 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLDRPI KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDRPISKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_006850855.1| hypothetical protein AMTR_s00025p00141470 [Amborella trichopoda] gi|548854526|gb|ERN12436.1| hypothetical protein AMTR_s00025p00141470 [Amborella trichopoda] Length = 194 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGK+KQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKVKQYTNVLDKPLSKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_006473978.1| PREDICTED: trafficking protein particle complex subunit 5-like [Citrus sinensis] Length = 194 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_006453660.1| hypothetical protein CICLE_v10009392mg [Citrus clementina] gi|557556886|gb|ESR66900.1| hypothetical protein CICLE_v10009392mg [Citrus clementina] Length = 222 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 29 MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQ 67 >ref|XP_006453659.1| hypothetical protein CICLE_v10009392mg [Citrus clementina] gi|557556885|gb|ESR66899.1| hypothetical protein CICLE_v10009392mg [Citrus clementina] Length = 226 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 29 MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQ 67 >ref|XP_007011967.1| Transport protein particle (TRAPP) component [Theobroma cacao] gi|508782330|gb|EOY29586.1| Transport protein particle (TRAPP) component [Theobroma cacao] Length = 194 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_007204907.1| hypothetical protein PRUPE_ppa011818mg [Prunus persica] gi|462400438|gb|EMJ06106.1| hypothetical protein PRUPE_ppa011818mg [Prunus persica] Length = 194 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_002523497.1| Transport protein particle subunit trs31, putative [Ricinus communis] gi|223537204|gb|EEF38836.1| Transport protein particle subunit trs31, putative [Ricinus communis] Length = 194 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_002279200.1| PREDICTED: trafficking protein particle complex subunit 5 [Vitis vinifera] gi|297743638|emb|CBI36521.3| unnamed protein product [Vitis vinifera] Length = 194 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_004510694.1| PREDICTED: trafficking protein particle complex subunit 5-like isoform X1 [Cicer arietinum] gi|502156918|ref|XP_004510695.1| PREDICTED: trafficking protein particle complex subunit 5-like isoform X2 [Cicer arietinum] gi|502156921|ref|XP_004510696.1| PREDICTED: trafficking protein particle complex subunit 5-like isoform X3 [Cicer arietinum] Length = 194 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYGNVLDKPLAKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_006590273.1| PREDICTED: uncharacterized protein LOC100527008 isoform X1 [Glycine max] Length = 194 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDKPLTKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_007163507.1| hypothetical protein PHAVU_001G239800g [Phaseolus vulgaris] gi|561036971|gb|ESW35501.1| hypothetical protein PHAVU_001G239800g [Phaseolus vulgaris] Length = 194 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGK+KQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKVKQYGNVLDKPLNKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_007163506.1| hypothetical protein PHAVU_001G239800g [Phaseolus vulgaris] gi|561036970|gb|ESW35500.1| hypothetical protein PHAVU_001G239800g [Phaseolus vulgaris] Length = 222 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGK+KQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKVKQYGNVLDKPLNKGKQEVSLSAFAFLFSELVQ 39 >ref|NP_001237223.1| uncharacterized protein LOC100527008 [Glycine max] gi|255631356|gb|ACU16045.1| unknown [Glycine max] Length = 194 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDKPLTKGKQEVSLSAFAFLFSELVQ 39 >gb|EMT00646.1| hypothetical protein F775_28372 [Aegilops tauschii] Length = 192 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGK KQY NVLD+P+G+G+QEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKAKQYANVLDKPLGRGRQEVSLSAFAFLFSELVQ 39 >ref|XP_004140592.1| PREDICTED: trafficking protein particle complex subunit 5-like [Cucumis sativus] gi|449521790|ref|XP_004167912.1| PREDICTED: trafficking protein particle complex subunit 5-like [Cucumis sativus] Length = 194 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVL++P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLEKPLSKGKQEVSLSAFAFLFSELVQ 39 >ref|XP_002308390.1| transport protein particle component Bet3 [Populus trichocarpa] gi|118483059|gb|ABK93439.1| unknown [Populus trichocarpa] gi|222854366|gb|EEE91913.1| transport protein particle component Bet3 [Populus trichocarpa] Length = 194 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVL++P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLEKPLSKGKQEVSLSAFAFLFSELVQ 39 >gb|EPS63030.1| hypothetical protein M569_11758, partial [Genlisea aurea] Length = 186 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MI VGK+KQY N+LDRP+GKGKQEVSLSAF FLFSELVQ Sbjct: 1 MIAVGKMKQYANLLDRPLGKGKQEVSLSAFGFLFSELVQ 39 >gb|AFK42122.1| unknown [Lotus japonicus] Length = 194 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGK+KQY NVLD+P+ KGKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKMKQYSNVLDKPLTKGKQEVSLSAFAFLFSELVQ 39 >ref|NP_001237511.1| uncharacterized protein LOC100500147 [Glycine max] gi|255629460|gb|ACU15076.1| unknown [Glycine max] Length = 194 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 118 MIGVGKIKQYVNVLDRPIGKGKQEVSLSAFAFLFSELVQ 2 MIGVGKIKQY NVLD+P+ +GKQEVSLSAFAFLFSELVQ Sbjct: 1 MIGVGKIKQYSNVLDKPLTRGKQEVSLSAFAFLFSELVQ 39