BLASTX nr result
ID: Mentha23_contig00004020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00004020 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362241.1| PREDICTED: uncharacterized protein LOC102581... 66 6e-09 ref|XP_006362240.1| PREDICTED: uncharacterized protein LOC102581... 55 8e-06 >ref|XP_006362241.1| PREDICTED: uncharacterized protein LOC102581026 isoform X2 [Solanum tuberosum] Length = 761 Score = 65.9 bits (159), Expect = 6e-09 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 7/105 (6%) Frame = +3 Query: 3 EFPLLAELEIRDCEKMRCLVS-------SRNDESNSEGHYEDHDSSHLLCQPKVSFPNLK 161 EFPLL E+EI DC +M V + + N++ + D + ++ KVS PNLK Sbjct: 501 EFPLLREVEIDDCPEMNMFVQHGIFMSIASLESVNNDDEVKAVDLNKVMFNSKVSCPNLK 560 Query: 162 KLYLSARNVECKNVWCDKVPIAFFSGLVKLEIYYYGKIRRLFSSS 296 KLY++ N + C ++P A+FS LVKLE+ K+R L S S Sbjct: 561 KLYINGAN-SISALCCHQLPTAYFSKLVKLEVTSCEKLRNLMSPS 604 >ref|XP_006362240.1| PREDICTED: uncharacterized protein LOC102581026 isoform X1 [Solanum tuberosum] Length = 926 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 7/105 (6%) Frame = +3 Query: 3 EFPLLAELEIRDCEKMRCLVSSRNDES-------NSEGHYEDHDSSHLLCQPKVSFPNLK 161 +FP L + I +C KM+ V R N++ + D + + KVS PNLK Sbjct: 666 KFPFLKLVIIFECPKMKTFVQQRVYTGTASLISVNNDDEVKVVDLNKAMFNYKVSCPNLK 725 Query: 162 KLYLSARNVECKNVWCDKVPIAFFSGLVKLEIYYYGKIRRLFSSS 296 KLY++ N + C ++P A+FS LVKLE+ K+R L S S Sbjct: 726 KLYINGAN-SISALCCHQLPTAYFSKLVKLEVTSCEKLRNLMSPS 769