BLASTX nr result
ID: Mentha23_contig00003299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00003299 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45365.1| hypothetical protein MIMGU_mgv1a011735mg [Mimulus... 61 2e-07 >gb|EYU45365.1| hypothetical protein MIMGU_mgv1a011735mg [Mimulus guttatus] Length = 272 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -3 Query: 140 PQFQKSSFQGVSVQEAKRAVFNSLVLEG-ISTSSVRSVRKRGLEVNA 3 PQFQK+SFQG+S+Q+AKR VFNSLV E I S+V+SVR+RG E+ A Sbjct: 33 PQFQKTSFQGLSIQDAKRVVFNSLVSERIIINSNVKSVRERGFEITA 79