BLASTX nr result
ID: Mentha23_contig00002897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00002897 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45100.1| hypothetical protein MIMGU_mgv1a004600mg [Mimulus... 57 3e-06 >gb|EYU45100.1| hypothetical protein MIMGU_mgv1a004600mg [Mimulus guttatus] Length = 518 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 111 MGWLSKIFKCSDHKVLDGHSDWRYGADTAETHQSAS 4 MGWLSKIFK S+HKV +G DWRYGADT E + ++S Sbjct: 1 MGWLSKIFKGSEHKVSEGRYDWRYGADTVENNPASS 36