BLASTX nr result
ID: Mentha23_contig00002652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00002652 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45565.1| hypothetical protein MIMGU_mgv1a001885mg [Mimulus... 131 1e-28 gb|EYU43928.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus... 131 1e-28 gb|EPS73417.1| hypothetical protein M569_01333 [Genlisea aurea] 131 1e-28 ref|XP_004229226.1| PREDICTED: cullin-1-like [Solanum lycopersicum] 131 1e-28 emb|CAC87837.1| cullin 1C [Nicotiana tabacum] 131 1e-28 gb|ABB77428.1| cullin 1-like protein C [Petunia integrifolia sub... 130 2e-28 ref|XP_004508284.1| PREDICTED: cullin-1-like [Cicer arietinum] 127 2e-27 ref|XP_003609639.1| Cullin-like protein1 [Medicago truncatula] g... 127 2e-27 ref|XP_007226992.1| hypothetical protein PRUPE_ppa001901mg [Prun... 126 4e-27 emb|CCH26221.1| CUL1 protein [Pyrus x bretschneideri] 126 4e-27 gb|AFJ21665.1| cullin 1-like protein B [Prunus avium] 126 4e-27 ref|XP_006342782.1| PREDICTED: cullin-1-like [Solanum tuberosum] 125 5e-27 ref|XP_003550217.1| PREDICTED: cullin-1-like isoform 1 [Glycine ... 125 5e-27 gb|EXB74807.1| hypothetical protein L484_023551 [Morus notabilis] 125 6e-27 ref|XP_007198998.1| hypothetical protein PRUPE_ppa001948mg [Prun... 125 6e-27 gb|AFJ21664.1| cullin 1-like protein A [Prunus avium] 125 6e-27 ref|XP_002516899.1| Cullin-1, putative [Ricinus communis] gi|223... 125 8e-27 ref|XP_002314453.2| cullin-like protein1 [Populus trichocarpa] g... 124 1e-26 ref|XP_006380173.1| cullin-like protein1 [Populus trichocarpa] g... 124 1e-26 ref|XP_007154255.1| hypothetical protein PHAVU_003G103300g [Phas... 124 1e-26 >gb|EYU45565.1| hypothetical protein MIMGU_mgv1a001885mg [Mimulus guttatus] Length = 744 Score = 131 bits (329), Expect = 1e-28 Identities = 65/65 (100%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL Sbjct: 680 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 739 Query: 182 FKYLA 196 FKYLA Sbjct: 740 FKYLA 744 >gb|EYU43928.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus guttatus] gi|604345347|gb|EYU43929.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus guttatus] Length = 744 Score = 131 bits (329), Expect = 1e-28 Identities = 65/65 (100%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL Sbjct: 680 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 739 Query: 182 FKYLA 196 FKYLA Sbjct: 740 FKYLA 744 >gb|EPS73417.1| hypothetical protein M569_01333 [Genlisea aurea] Length = 744 Score = 131 bits (329), Expect = 1e-28 Identities = 65/65 (100%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL Sbjct: 680 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 739 Query: 182 FKYLA 196 FKYLA Sbjct: 740 FKYLA 744 >ref|XP_004229226.1| PREDICTED: cullin-1-like [Solanum lycopersicum] Length = 742 Score = 131 bits (329), Expect = 1e-28 Identities = 65/65 (100%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL Sbjct: 678 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 737 Query: 182 FKYLA 196 FKYLA Sbjct: 738 FKYLA 742 >emb|CAC87837.1| cullin 1C [Nicotiana tabacum] Length = 447 Score = 131 bits (329), Expect = 1e-28 Identities = 65/65 (100%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL Sbjct: 383 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 442 Query: 182 FKYLA 196 FKYLA Sbjct: 443 FKYLA 447 >gb|ABB77428.1| cullin 1-like protein C [Petunia integrifolia subsp. inflata] Length = 742 Score = 130 bits (326), Expect = 2e-28 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQ+LVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL Sbjct: 678 DASIVRIMKSRKVLGYQELVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 737 Query: 182 FKYLA 196 FKYLA Sbjct: 738 FKYLA 742 >ref|XP_004508284.1| PREDICTED: cullin-1-like [Cicer arietinum] Length = 744 Score = 127 bits (319), Expect = 2e-27 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLI+RDYLERDK+NPN+ Sbjct: 680 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLISRDYLERDKENPNM 739 Query: 182 FKYLA 196 FKYLA Sbjct: 740 FKYLA 744 >ref|XP_003609639.1| Cullin-like protein1 [Medicago truncatula] gi|355510694|gb|AES91836.1| Cullin-like protein1 [Medicago truncatula] Length = 929 Score = 127 bits (319), Expect = 2e-27 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLI+RDYLERDK+NPN+ Sbjct: 865 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLISRDYLERDKENPNM 924 Query: 182 FKYLA 196 FKYLA Sbjct: 925 FKYLA 929 >ref|XP_007226992.1| hypothetical protein PRUPE_ppa001901mg [Prunus persica] gi|462423928|gb|EMJ28191.1| hypothetical protein PRUPE_ppa001901mg [Prunus persica] Length = 744 Score = 126 bits (316), Expect = 4e-27 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLG+QQLVMECVEQLGRMFKPD KAIKKRIEDLITRDYLERDKDNPNL Sbjct: 680 DASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNL 739 Query: 182 FKYLA 196 F+YLA Sbjct: 740 FRYLA 744 >emb|CCH26221.1| CUL1 protein [Pyrus x bretschneideri] Length = 744 Score = 126 bits (316), Expect = 4e-27 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLG+QQLVMECVEQLGRMFKPD KAIKKRIEDLITRDYLERDKDNPNL Sbjct: 680 DASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNL 739 Query: 182 FKYLA 196 F+YLA Sbjct: 740 FRYLA 744 >gb|AFJ21665.1| cullin 1-like protein B [Prunus avium] Length = 744 Score = 126 bits (316), Expect = 4e-27 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLG+QQLVMECVEQLGRMFKPD KAIKKRIEDLITRDYLERDKDNPNL Sbjct: 680 DASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNL 739 Query: 182 FKYLA 196 F+YLA Sbjct: 740 FRYLA 744 >ref|XP_006342782.1| PREDICTED: cullin-1-like [Solanum tuberosum] Length = 742 Score = 125 bits (315), Expect = 5e-27 Identities = 62/64 (96%), Positives = 63/64 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLV+ECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKD PNL Sbjct: 678 DASIVRIMKSRKVLGYQQLVIECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDKPNL 737 Query: 182 FKYL 193 FKYL Sbjct: 738 FKYL 741 >ref|XP_003550217.1| PREDICTED: cullin-1-like isoform 1 [Glycine max] Length = 744 Score = 125 bits (315), Expect = 5e-27 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLI+RDYLERDKDN N+ Sbjct: 680 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLISRDYLERDKDNANM 739 Query: 182 FKYLA 196 FKYLA Sbjct: 740 FKYLA 744 >gb|EXB74807.1| hypothetical protein L484_023551 [Morus notabilis] Length = 753 Score = 125 bits (314), Expect = 6e-27 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLG+QQLVMECVEQLGRMFKPD KAIKKRIEDLITRDYLERDKDNPN+ Sbjct: 689 DASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNM 748 Query: 182 FKYLA 196 F+YLA Sbjct: 749 FRYLA 753 >ref|XP_007198998.1| hypothetical protein PRUPE_ppa001948mg [Prunus persica] gi|462394398|gb|EMJ00197.1| hypothetical protein PRUPE_ppa001948mg [Prunus persica] Length = 738 Score = 125 bits (314), Expect = 6e-27 Identities = 60/65 (92%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DA+IVRIMKSRKVLG+QQLVMECVEQLGRMFKPD+KAIKKRIEDLITRDYLERDK+NPN+ Sbjct: 674 DAAIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDIKAIKKRIEDLITRDYLERDKENPNM 733 Query: 182 FKYLA 196 FKYLA Sbjct: 734 FKYLA 738 >gb|AFJ21664.1| cullin 1-like protein A [Prunus avium] Length = 738 Score = 125 bits (314), Expect = 6e-27 Identities = 60/65 (92%), Positives = 65/65 (100%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DA+IVRIMKSRKVLG+QQLVMECVEQLGRMFKPD+KAIKKRIEDLITRDYLERDK+NPN+ Sbjct: 674 DAAIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDIKAIKKRIEDLITRDYLERDKENPNM 733 Query: 182 FKYLA 196 FKYLA Sbjct: 734 FKYLA 738 >ref|XP_002516899.1| Cullin-1, putative [Ricinus communis] gi|223543987|gb|EEF45513.1| Cullin-1, putative [Ricinus communis] Length = 744 Score = 125 bits (313), Expect = 8e-27 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLG+QQLV+ECVEQLGRMFKPD KAIKKRIEDLITRDYLERDKDNPNL Sbjct: 680 DASIVRIMKSRKVLGHQQLVLECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNL 739 Query: 182 FKYLA 196 F+YLA Sbjct: 740 FRYLA 744 >ref|XP_002314453.2| cullin-like protein1 [Populus trichocarpa] gi|550328945|gb|EEF00624.2| cullin-like protein1 [Populus trichocarpa] Length = 744 Score = 124 bits (312), Expect = 1e-26 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLG+QQLVMECVEQLGRMFKPD KAIKKRIEDLITRDYLERDK+NPNL Sbjct: 680 DASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKENPNL 739 Query: 182 FKYLA 196 F+YLA Sbjct: 740 FRYLA 744 >ref|XP_006380173.1| cullin-like protein1 [Populus trichocarpa] gi|550333694|gb|ERP57970.1| cullin-like protein1 [Populus trichocarpa] Length = 744 Score = 124 bits (312), Expect = 1e-26 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLG+QQLVMECVEQLGRMFKPD KAIKKRIEDLITRDYLERDK+NPNL Sbjct: 680 DASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKENPNL 739 Query: 182 FKYLA 196 F+YLA Sbjct: 740 FRYLA 744 >ref|XP_007154255.1| hypothetical protein PHAVU_003G103300g [Phaseolus vulgaris] gi|561027609|gb|ESW26249.1| hypothetical protein PHAVU_003G103300g [Phaseolus vulgaris] Length = 744 Score = 124 bits (311), Expect = 1e-26 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = +2 Query: 2 DASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNL 181 DASIVRIMKSRKVLGYQQLV+ECVEQLGRMFKPDVKAIKKRIEDLI+RDYLERDKDN N+ Sbjct: 680 DASIVRIMKSRKVLGYQQLVVECVEQLGRMFKPDVKAIKKRIEDLISRDYLERDKDNANM 739 Query: 182 FKYLA 196 FKYLA Sbjct: 740 FKYLA 744