BLASTX nr result
ID: Mentha23_contig00001387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00001387 (3149 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34048.1| hypothetical protein MIMGU_mgv1a020264mg [Mimulus... 62 2e-06 >gb|EYU34048.1| hypothetical protein MIMGU_mgv1a020264mg [Mimulus guttatus] Length = 118 Score = 61.6 bits (148), Expect = 2e-06 Identities = 37/72 (51%), Positives = 42/72 (58%), Gaps = 4/72 (5%) Frame = -1 Query: 3146 VVGESIDAVELTRQLRKGVGHAELVSVGEDKKEDXXXXXXXXXXXXXPWSYV----YPPP 2979 VVG+ +DAVELTRQLRK V +AELVSVGE KKE P V Y P Sbjct: 35 VVGDDVDAVELTRQLRKNVAYAELVSVGEAKKEAPATAAAAAVVAPAPQPGVVWTSYAAP 94 Query: 2978 YAGYNSYPIYEV 2943 Y G+ YPIYE+ Sbjct: 95 YDGFPQYPIYEM 106