BLASTX nr result
ID: Mentha23_contig00001348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00001348 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum] 131 1e-28 gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata] 131 1e-28 emb|CAA56143.1| CYS1 [Arabidopsis thaliana] 130 2e-28 emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana] 130 2e-28 gb|AAC25687.1| cystathionine gamma-synthase precursor [Arabidops... 130 2e-28 gb|AAC49574.1| similar to the metB gene product of Escherichia c... 130 2e-28 ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thali... 130 2e-28 ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arab... 130 2e-28 emb|CBI22246.3| unnamed protein product [Vitis vinifera] 130 2e-28 ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chl... 130 2e-28 gb|EYU44131.1| hypothetical protein MIMGU_mgv1a002982mg [Mimulus... 129 3e-28 ref|NP_001275144.1| cystathionine gamma-synthase isoform 2 [Sola... 129 3e-28 gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 ... 129 3e-28 ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycope... 129 3e-28 gb|EYU34642.1| hypothetical protein MIMGU_mgv1a004543mg [Mimulus... 128 7e-28 gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum] 128 7e-28 pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana ... 128 7e-28 gb|AAM13883.1| putative cystathionine gamma-synthase [Arabidopsi... 128 7e-28 ref|XP_006482629.1| PREDICTED: cystathionine gamma-synthase, chl... 128 9e-28 ref|XP_006431204.1| hypothetical protein CICLE_v10011434mg [Citr... 128 9e-28 >gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum] Length = 527 Score = 131 bits (329), Expect = 1e-28 Identities = 62/69 (89%), Positives = 66/69 (95%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 +D+L IPYIAPSFGGCESIVDQPAIMSYWDL QS+RAKYGILDNLVRFSFGVEDFEDLKA Sbjct: 459 IDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKA 518 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 519 DILQALEAI 527 >gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata] Length = 553 Score = 131 bits (329), Expect = 1e-28 Identities = 62/69 (89%), Positives = 66/69 (95%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 +D+L IPYIAPSFGGCESIVDQPAIMSYWDL QS+RAKYGILDNLVRFSFGVEDFEDLKA Sbjct: 485 IDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKA 544 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 545 DILQALEAI 553 >emb|CAA56143.1| CYS1 [Arabidopsis thaliana] Length = 224 Score = 130 bits (326), Expect = 2e-28 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VDSL IPYIAPSFGGCESIVDQPAIMSYWDLPQ ER KYGI DNLVRFSFGVEDFED+KA Sbjct: 156 VDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKA 215 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 216 DILQALEAI 224 >emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana] Length = 563 Score = 130 bits (326), Expect = 2e-28 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VDSL IPYIAPSFGGCESIVDQPAIMSYWDLPQ ER KYGI DNLVRFSFGVEDFED+KA Sbjct: 495 VDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKA 554 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 555 DILQALEAI 563 >gb|AAC25687.1| cystathionine gamma-synthase precursor [Arabidopsis thaliana] Length = 563 Score = 130 bits (326), Expect = 2e-28 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VDSL IPYIAPSFGGCESIVDQPAIMSYWDLPQ ER KYGI DNLVRFSFGVEDFED+KA Sbjct: 495 VDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKA 554 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 555 DILQALEAI 563 >gb|AAC49574.1| similar to the metB gene product of Escherichia coli; cloned by functional complementation of a metB mutant strain of Escherichia coli LE392 [Arabidopsis thaliana] Length = 563 Score = 130 bits (326), Expect = 2e-28 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VDSL IPYIAPSFGGCESIVDQPAIMSYWDLPQ ER KYGI DNLVRFSFGVEDFED+KA Sbjct: 495 VDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKA 554 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 555 DILQALEAI 563 >ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|21542422|sp|P55217.3|METB_ARATH RecName: Full=Cystathionine gamma-synthase, chloroplastic; Short=CGS; AltName: Full=O-succinylhomoserine (thiol)-lyase; Flags: Precursor gi|6714476|gb|AAF26162.1|AC008261_19 putative cystathionine gamma-synthase [Arabidopsis thaliana] gi|1791309|gb|AAB41235.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|2852454|dbj|BAA24699.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|20453137|gb|AAM19810.1| AT3g01120/T4P13_19 [Arabidopsis thaliana] gi|27754257|gb|AAO22582.1| putative cystathionine gamma-synthase [Arabidopsis thaliana] gi|332640091|gb|AEE73612.1| cystathionine gamma-synthase [Arabidopsis thaliana] Length = 563 Score = 130 bits (326), Expect = 2e-28 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VDSL IPYIAPSFGGCESIVDQPAIMSYWDLPQ ER KYGI DNLVRFSFGVEDFED+KA Sbjct: 495 VDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKA 554 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 555 DILQALEAI 563 >ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. lyrata] gi|297328039|gb|EFH58458.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. lyrata] Length = 564 Score = 130 bits (326), Expect = 2e-28 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VDSL IPYIAPSFGGCESIVDQPAIMSYWDLPQ ER KYGI DNLVRFSFGVEDFED+KA Sbjct: 496 VDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKA 555 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 556 DILQALEAI 564 >emb|CBI22246.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 130 bits (326), Expect = 2e-28 Identities = 63/69 (91%), Positives = 65/69 (94%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VD+L IPYIAPSFGGCESIVDQPAIMSYWDL QSERAKYGI DNLVRFSFGVEDFEDLKA Sbjct: 429 VDALKIPYIAPSFGGCESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKA 488 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 489 DILQALESI 497 >ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Vitis vinifera] Length = 531 Score = 130 bits (326), Expect = 2e-28 Identities = 63/69 (91%), Positives = 65/69 (94%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VD+L IPYIAPSFGGCESIVDQPAIMSYWDL QSERAKYGI DNLVRFSFGVEDFEDLKA Sbjct: 463 VDALKIPYIAPSFGGCESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKA 522 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 523 DILQALESI 531 >gb|EYU44131.1| hypothetical protein MIMGU_mgv1a002982mg [Mimulus guttatus] Length = 619 Score = 129 bits (325), Expect = 3e-28 Identities = 62/69 (89%), Positives = 65/69 (94%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VD+L IPYIAPSFGGCESIVDQPAIMSYWDL SERAKYGI+DNLVRFSFGVEDFEDLKA Sbjct: 551 VDALRIPYIAPSFGGCESIVDQPAIMSYWDLSPSERAKYGIMDNLVRFSFGVEDFEDLKA 610 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 611 DILQALEKI 619 >ref|NP_001275144.1| cystathionine gamma-synthase isoform 2 [Solanum tuberosum] gi|8439543|gb|AAF74982.1|AF082892_1 cystathionine gamma-synthase isoform 2 [Solanum tuberosum] Length = 540 Score = 129 bits (325), Expect = 3e-28 Identities = 61/67 (91%), Positives = 65/67 (97%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VD+L IPYIAPSFGGCESIVDQPAIMSYWDL +SERAKYGI+DNLVRFSFGVEDFEDLKA Sbjct: 472 VDALKIPYIAPSFGGCESIVDQPAIMSYWDLKESERAKYGIMDNLVRFSFGVEDFEDLKA 531 Query: 183 DVLQALE 203 D+LQALE Sbjct: 532 DILQALE 538 >gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 [Solanum tuberosum] Length = 539 Score = 129 bits (325), Expect = 3e-28 Identities = 62/69 (89%), Positives = 66/69 (95%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VD+L IPYIAPSFGGCESIVDQPAIMSYWDL QS+RAKYGILDNLVRFSFGVEDFED+KA Sbjct: 471 VDALRIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKA 530 Query: 183 DVLQALEMI 209 DVLQAL+ I Sbjct: 531 DVLQALDSI 539 >ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycopersicum] gi|40806079|gb|AAR92031.1| cystathionine gamma synthase [Solanum lycopersicum] Length = 540 Score = 129 bits (325), Expect = 3e-28 Identities = 62/69 (89%), Positives = 66/69 (95%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VD+L IPYIAPSFGGCESIVDQPAIMSYWDL QS+RAKYGILDNLVRFSFGVEDFED+KA Sbjct: 472 VDALRIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKA 531 Query: 183 DVLQALEMI 209 DVLQAL+ I Sbjct: 532 DVLQALDSI 540 >gb|EYU34642.1| hypothetical protein MIMGU_mgv1a004543mg [Mimulus guttatus] Length = 521 Score = 128 bits (322), Expect = 7e-28 Identities = 60/69 (86%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 +D+L IPYIAPSFGGCESIVDQPAIMSYWDL Q ERAKYGI+DNLVRFSFGVEDFEDLK Sbjct: 453 IDALRIPYIAPSFGGCESIVDQPAIMSYWDLSQKERAKYGIMDNLVRFSFGVEDFEDLKT 512 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 513 DILQALEKI 521 >gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum] Length = 540 Score = 128 bits (322), Expect = 7e-28 Identities = 60/69 (86%), Positives = 66/69 (95%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VD+L IPYIAPSFGGCESIVDQPAIMSYWDL QS+RAKYGI+DNLVRFSFGVEDF+DLKA Sbjct: 472 VDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKA 531 Query: 183 DVLQALEMI 209 D+LQAL+ I Sbjct: 532 DILQALDSI 540 >pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822271|pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822272|pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822273|pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822274|pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822275|pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822276|pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822277|pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|15826471|pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826472|pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826473|pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826474|pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826475|pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826476|pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826477|pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826478|pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826479|pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826480|pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826481|pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826482|pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826483|pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826484|pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826485|pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826486|pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826487|pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826488|pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826489|pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826490|pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826491|pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826492|pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826493|pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826494|pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826495|pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826496|pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826497|pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826498|pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826499|pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826500|pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826501|pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826502|pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826503|pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826504|pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826505|pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826506|pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|4322948|gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum] Length = 445 Score = 128 bits (322), Expect = 7e-28 Identities = 60/69 (86%), Positives = 66/69 (95%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VD+L IPYIAPSFGGCESIVDQPAIMSYWDL QS+RAKYGI+DNLVRFSFGVEDF+DLKA Sbjct: 377 VDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKA 436 Query: 183 DVLQALEMI 209 D+LQAL+ I Sbjct: 437 DILQALDSI 445 >gb|AAM13883.1| putative cystathionine gamma-synthase [Arabidopsis thaliana] Length = 563 Score = 128 bits (322), Expect = 7e-28 Identities = 61/69 (88%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 VDSL IPYIAPSFGGCESIVDQPAIMSYWDLPQ ER KYGI DNLVRFSFGV+DFED+KA Sbjct: 495 VDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVKDFEDVKA 554 Query: 183 DVLQALEMI 209 D+LQALE I Sbjct: 555 DILQALEAI 563 >ref|XP_006482629.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Citrus sinensis] Length = 541 Score = 128 bits (321), Expect = 9e-28 Identities = 61/69 (88%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 +D+L IPYIAPSFGGCESIVDQPAIMSYWDL QSER KYGI+DNLVRFSFGVEDFEDLKA Sbjct: 473 IDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKA 532 Query: 183 DVLQALEMI 209 DVLQAL I Sbjct: 533 DVLQALHAI 541 >ref|XP_006431204.1| hypothetical protein CICLE_v10011434mg [Citrus clementina] gi|557533261|gb|ESR44444.1| hypothetical protein CICLE_v10011434mg [Citrus clementina] Length = 541 Score = 128 bits (321), Expect = 9e-28 Identities = 61/69 (88%), Positives = 64/69 (92%) Frame = +3 Query: 3 VDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGILDNLVRFSFGVEDFEDLKA 182 +D+L IPYIAPSFGGCESIVDQPAIMSYWDL QSER KYGI+DNLVRFSFGVEDFEDLKA Sbjct: 473 IDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKA 532 Query: 183 DVLQALEMI 209 DVLQAL I Sbjct: 533 DVLQALHAI 541