BLASTX nr result
ID: Mentha23_contig00000366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00000366 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24282.1| hypothetical protein MIMGU_mgv1a017370mg [Mimulus... 64 3e-08 >gb|EYU24282.1| hypothetical protein MIMGU_mgv1a017370mg [Mimulus guttatus] Length = 79 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = -3 Query: 206 TFQQIYATSSTFQETTG-SFKLTTAAYDSEKNSQKVKRHRKEKYEQKVRKTPSGPSPVGN 30 + Q YA SSTFQET SFK +TA Y S ++Q R+ +E E+ +RK PS PSPVGN Sbjct: 16 SLQHCYAISSTFQETKSVSFKTSTAVYSSRNSNQ---RNTREANEKTIRKRPSEPSPVGN 72 Query: 29 NRPPTKA 9 RP T+A Sbjct: 73 RRPLTRA 79