BLASTX nr result
ID: Mentha22_contig00053740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00053740 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004143505.1| hypothetical protein [Mesorhizobium ciceri b... 65 1e-08 ref|WP_023773164.1| hypothetical protein [Mesorhizobium] gi|5631... 65 1e-08 ref|YP_004613298.1| hypothetical protein Mesop_4784 [Mesorhizobi... 65 1e-08 ref|WP_021227467.1| hypothetical protein [Sphingobium lactosuten... 64 2e-08 ref|WP_009822632.1| hypothetical protein [Sphingomonas sp. SKA58... 64 2e-08 ref|WP_006332917.1| conserved hypothetical protein [Mesorhizobiu... 64 2e-08 ref|NP_101956.1| hypothetical protein msr0083 [Mesorhizobium lot... 64 2e-08 ref|WP_007752108.1| hypothetical protein [Rhizobium sp. CF080] g... 64 2e-08 ref|WP_023810350.1| hypothetical protein [Mesorhizobium sp. L2C0... 64 3e-08 ref|YP_007306113.1| hypothetical protein Mesau_04402 [Mesorhizob... 64 3e-08 ref|XP_003343431.1| hypothetical protein SMAC_11791 [Sordaria ma... 64 3e-08 ref|WP_021317463.1| hypothetical protein [Sphingobium ummariense... 63 4e-08 ref|WP_023798236.1| hypothetical protein [Mesorhizobium sp. L48C... 63 5e-08 ref|WP_023759509.1| hypothetical protein [Mesorhizobium sp. LNHC... 63 5e-08 ref|WP_010407407.1| hypothetical protein [Sphingomonas echinoides] 63 5e-08 ref|WP_008836580.1| hypothetical protein [Mesorhizobium alhagi] ... 63 5e-08 ref|YP_002496768.1| hypothetical protein Mnod_1473 [Methylobacte... 63 5e-08 emb|CDM57510.1| putative conserved protein [Rhizobium sp. LPU83] 62 6e-08 ref|WP_010162063.1| hypothetical protein [Sphingomonas] 62 6e-08 ref|WP_010185365.1| hypothetical protein, partial [Sphingomonas ... 62 6e-08 >ref|YP_004143505.1| hypothetical protein [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|503297457|ref|WP_013532118.1| hypothetical protein [Mesorhizobium ciceri] gi|317169917|gb|ADV13455.1| Protein of unknown function DUF2171 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 84 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 DTS+I+EH EVVG+DG HVGTVDK++GQRIKLTK DS Sbjct: 3 DTSKIREHMEVVGADGVHVGTVDKVDGQRIKLTKADS 39 >ref|WP_023773164.1| hypothetical protein [Mesorhizobium] gi|563160481|gb|ESY84003.1| hypothetical protein X739_22875 [Mesorhizobium sp. LNHC220B00] gi|563168746|gb|ESY92092.1| hypothetical protein X741_20685 [Mesorhizobium sp. LNHC229A00] gi|563173575|gb|ESY96873.1| hypothetical protein X738_20260 [Mesorhizobium sp. LNHC209A00] Length = 84 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 DTS+I+EH EVVG+DG H+GTVDK++GQRIKLTK DS Sbjct: 3 DTSKIREHMEVVGADGVHIGTVDKVDGQRIKLTKADS 39 >ref|YP_004613298.1| hypothetical protein Mesop_4784 [Mesorhizobium opportunistum WSM2075] gi|503661779|ref|WP_013895855.1| hypothetical protein [Mesorhizobium] gi|336029553|gb|AEH89204.1| Protein of unknown function DUF2171 [Mesorhizobium opportunistum WSM2075] gi|563145726|gb|ESY69547.1| hypothetical protein X742_05355 [Mesorhizobium sp. LNHC232B00] gi|563159525|gb|ESY83056.1| hypothetical protein X740_03700 [Mesorhizobium sp. LNHC221B00] Length = 84 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 DTS+I+EH EVVG+DG H+GTVDK++GQRIKLTK DS Sbjct: 3 DTSKIREHMEVVGADGVHIGTVDKVDGQRIKLTKADS 39 >ref|WP_021227467.1| hypothetical protein [Sphingobium lactosutens] gi|530269990|gb|EQB12350.1| hypothetical protein RLDS_19580 [Sphingobium lactosutens DS20] Length = 88 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDSQA 3 VD S+IKEH EV+G+DG HVGTVD +EG RIKLTKKDS A Sbjct: 3 VDLSQIKEHAEVIGADGVHVGTVDHVEGDRIKLTKKDSGA 42 >ref|WP_009822632.1| hypothetical protein [Sphingomonas sp. SKA58] gi|94424475|gb|EAT09497.1| hypothetical protein SKA58_14412 [Sphingomonas sp. SKA58] Length = 88 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDSQA 3 VD S+IKEH EV+G+DG HVGTVD +EG RIKLTKKDS A Sbjct: 3 VDLSQIKEHAEVIGADGVHVGTVDHVEGDRIKLTKKDSGA 42 >ref|WP_006332917.1| conserved hypothetical protein [Mesorhizobium] gi|472143074|emb|CCV06582.1| conserved hypothetical protein [Mesorhizobium metallidurans STM 2683] gi|474661016|emb|CCV13363.1| conserved hypothetical protein [Mesorhizobium sp. STM 4661] Length = 84 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 D S+I+EH EV+G+DG HVGTVDK+EGQRIKLTK DS Sbjct: 3 DASKIREHMEVIGADGVHVGTVDKVEGQRIKLTKADS 39 >ref|NP_101956.1| hypothetical protein msr0083 [Mesorhizobium loti MAFF303099] gi|499211572|ref|WP_010909112.1| hypothetical protein [Mesorhizobium loti] gi|14021129|dbj|BAB47742.1| msr0083 [Mesorhizobium loti MAFF303099] gi|563517415|gb|ETA72771.1| hypothetical protein MesloDRAFT_1657 [Mesorhizobium loti R7A] Length = 84 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 DTS+I+EH EVVG+DG H+GTVDK++GQRIKLTK DS Sbjct: 3 DTSKIREHMEVVGADGVHLGTVDKVDGQRIKLTKADS 39 >ref|WP_007752108.1| hypothetical protein [Rhizobium sp. CF080] gi|576717052|gb|EUB95641.1| Protein of unknown function DUF2171 [Rhizobium sp. CF080] Length = 86 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 +D +RIKEH EV+G+DG HVGTVD++EG RIKLT+KDS Sbjct: 2 IDAARIKEHAEVIGADGVHVGTVDRVEGSRIKLTRKDS 39 >ref|WP_023810350.1| hypothetical protein [Mesorhizobium sp. L2C084A000] gi|563204935|gb|ESZ27777.1| hypothetical protein X734_10195 [Mesorhizobium sp. L2C084A000] Length = 84 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 DTS+I+EH EVVG+DG HVGTVD+++GQRIKLTK DS Sbjct: 3 DTSKIREHMEVVGADGVHVGTVDEVDGQRIKLTKADS 39 >ref|YP_007306113.1| hypothetical protein Mesau_04402 [Mesorhizobium australicum WSM2073] gi|505131024|ref|WP_015318126.1| hypothetical protein [Mesorhizobium australicum] gi|433667661|gb|AGB46737.1| hypothetical protein Mesau_04402 [Mesorhizobium australicum WSM2073] Length = 84 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 DTS+I+EH +VVG+DG H+GTVDK++GQRIKLTK DS Sbjct: 3 DTSKIREHMDVVGADGVHIGTVDKVDGQRIKLTKADS 39 >ref|XP_003343431.1| hypothetical protein SMAC_11791 [Sordaria macrospora k-hell] Length = 92 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDSQA 3 D S IKEH EV+G+DG HVGTVD++EG RIKLTKKDS A Sbjct: 3 DLSNIKEHAEVIGADGVHVGTVDRVEGDRIKLTKKDSGA 41 >ref|WP_021317463.1| hypothetical protein [Sphingobium ummariense] gi|530442268|gb|EQB32743.1| hypothetical protein M529_07855 [Sphingobium ummariense RL-3] Length = 88 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDSQA 3 VD S IKEH EV+G+DG HVGTVD ++G RIKLTKKDS A Sbjct: 3 VDLSSIKEHAEVIGADGVHVGTVDHVDGNRIKLTKKDSSA 42 >ref|WP_023798236.1| hypothetical protein [Mesorhizobium sp. L48C026A00] gi|563197816|gb|ESZ20780.1| hypothetical protein X737_08140 [Mesorhizobium sp. L48C026A00] Length = 84 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 D + I+EH EV+G+DG HVGTVDK+EGQRIKLTK+DS Sbjct: 3 DAASIREHMEVIGADGVHVGTVDKVEGQRIKLTKRDS 39 >ref|WP_023759509.1| hypothetical protein [Mesorhizobium sp. LNHC252B00] gi|563148927|gb|ESY72669.1| hypothetical protein X743_15260 [Mesorhizobium sp. LNHC252B00] Length = 84 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 DTS+I+EH EVVG+DG HVGTVDK++GQRIKL K DS Sbjct: 3 DTSKIREHMEVVGADGVHVGTVDKVDGQRIKLIKADS 39 >ref|WP_010407407.1| hypothetical protein [Sphingomonas echinoides] Length = 86 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDSQA 3 VD S+IKEH EV+G+DG HVGTVD ++G RIKLTKKDS A Sbjct: 2 VDASQIKEHAEVIGADGVHVGTVDHVQGGRIKLTKKDSGA 41 >ref|WP_008836580.1| hypothetical protein [Mesorhizobium alhagi] gi|359253295|gb|EHK56445.1| hypothetical protein MAXJ12_14790 [Mesorhizobium alhagi CCNWXJ12-2] Length = 79 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 119 DTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 D S I+EH EV+G+DG H+GTVDK+EGQRIKLT+KDS Sbjct: 3 DMSGIREHMEVIGADGVHIGTVDKVEGQRIKLTRKDS 39 >ref|YP_002496768.1| hypothetical protein Mnod_1473 [Methylobacterium nodulans ORS 2060] gi|506408442|ref|WP_015928161.1| hypothetical protein [Methylobacterium nodulans] gi|219946073|gb|ACL56465.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060] Length = 77 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDSQA 3 VDTSRIKEH VVGSDG HVGTVD ++GQRIKLT D A Sbjct: 2 VDTSRIKEHMPVVGSDGGHVGTVDHLDGQRIKLTASDPDA 41 >emb|CDM57510.1| putative conserved protein [Rhizobium sp. LPU83] Length = 85 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDS 9 VD +IKEH EV+G+DG HVGTVD +EG RIKLTKKDS Sbjct: 2 VDAGQIKEHAEVIGADGVHVGTVDHVEGHRIKLTKKDS 39 >ref|WP_010162063.1| hypothetical protein [Sphingomonas] Length = 86 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDSQA 3 VD S+I+EH EV+G+DG HVGTVD +EG RIKLTKKDS A Sbjct: 2 VDASQIQEHAEVIGADGVHVGTVDHVEGGRIKLTKKDSGA 41 >ref|WP_010185365.1| hypothetical protein, partial [Sphingomonas sp. PAMC 26605] Length = 86 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 VDTSRIKEHQEVVGSDGQHVGTVDKIEGQRIKLTKKDSQA 3 VD S+I+EH EV+G+DG HVGTVD +EG RIKLTKKDS A Sbjct: 2 VDASQIQEHAEVIGADGVHVGTVDHVEGGRIKLTKKDSGA 41