BLASTX nr result
ID: Mentha22_contig00053515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00053515 (541 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006584232.1| PREDICTED: uncharacterized protein LOC102663... 57 2e-06 >ref|XP_006584232.1| PREDICTED: uncharacterized protein LOC102663276 [Glycine max] Length = 640 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 12/68 (17%) Frame = +3 Query: 39 NKKVDAARG-----HKPNN-------STTAKATVKLLTSVEMATRREKGLCYNCDEKYVL 182 +K +D RG + PN+ TT+K +K LT EMATRRE+GLCY CDEK+ Sbjct: 228 DKLLDRRRGPRAPPYNPNSLPSNRTPPTTSKVPIKRLTPEEMATRREQGLCYQCDEKWAH 287 Query: 183 GRKCKHKV 206 G +CK ++ Sbjct: 288 GHRCKSRL 295