BLASTX nr result
ID: Mentha22_contig00053498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00053498 (682 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006673560.1| transcriptional corepressor of histone (Hir3... 60 5e-07 >ref|XP_006673560.1| transcriptional corepressor of histone (Hir3), putative [Cordyceps militaris CM01] gi|346318713|gb|EGX88315.1| transcriptional corepressor of histone (Hir3), putative [Cordyceps militaris CM01] Length = 2153 Score = 60.5 bits (145), Expect = 5e-07 Identities = 40/110 (36%), Positives = 56/110 (50%) Frame = -3 Query: 668 EDVHMSENGEAGEVGFEKCQGDVGTRGNEGMSVEVRENGEDGEEGLKKEQDDVGTKENEK 489 EDV S+ GE GE G E +G+ G G EG E E GE+GEEG + E+D+ +E E+ Sbjct: 2030 EDVIGSDEGEEGEEGEEGEEGEEGEEGEEGEEGEEGEEGEEGEEGEEGEEDEEDEEEGEE 2089 Query: 488 MSVEVREDVCNVRESEKSEYLAQENGGPASAVEEGRENGCNVRESEKSDD 339 + ED N E E+ E ++ G EEG + G E+ D+ Sbjct: 2090 DGED--EDGENNAEDEEDEG-DEDEGEEEDGAEEGGDEGEGDENEEEEDE 2136