BLASTX nr result
ID: Mentha22_contig00052402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00052402 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 74 2e-11 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -2 Query: 484 LAWKARGYSRRRFSALNVSNSKPNVKLWFHSAPLWK 377 LAWKA+GYSRRRFS+L+VSNSKPN+KLWFHSAPLW+ Sbjct: 22 LAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57