BLASTX nr result
ID: Mentha22_contig00052278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00052278 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ67044.1| hypothetical protein BGT96224_A21122 [Blumeria gr... 78 1e-12 gb|ESZ97295.1| hypothetical protein SBOR_2323 [Sclerotinia borea... 60 4e-07 emb|CCD53491.1| similar to nuclear transport factor 2 domain pro... 59 7e-07 ref|XP_001559620.1| hypothetical protein BC1G_01776 [Botryotinia... 59 7e-07 ref|XP_001587156.1| hypothetical protein SS1G_12186 [Sclerotinia... 59 9e-07 >gb|EPQ67044.1| hypothetical protein BGT96224_A21122 [Blumeria graminis f. sp. tritici 96224] Length = 157 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = +2 Query: 5 SVVVLISGSVIYWKDNEEGETRGFTETVVLVPNP-EASSKSAKGKVRKWSILSQNFRLI 178 S+ V++SGSV YW + EEG+TRGFTE++VLVPN SK AKG RKW ILSQ FRLI Sbjct: 98 SITVMVSGSVRYWMEGEEGDTRGFTESIVLVPNKGSRESKIAKGTTRKWLILSQTFRLI 156 >gb|ESZ97295.1| hypothetical protein SBOR_2323 [Sclerotinia borealis F-4157] Length = 172 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +2 Query: 5 SVVVLISGSVIYW-KDNEEGETRGFTETVVLVPNPEASSKSAKGKVRKWSILSQNFRLIL 181 S+VV+++G V Y K+ +EGE R F ET VLVPN EA ++ A ++KW I SQ FRL+L Sbjct: 113 SIVVMVNGQVKYSSKNGDEGEERSFMETFVLVPNMEARNQKAPKGIKKWLIRSQVFRLVL 172 >emb|CCD53491.1| similar to nuclear transport factor 2 domain protein [Botryotinia fuckeliana T4] gi|472245839|gb|EMR90398.1| putative nuclear transport factor 2 domain-containing protein [Botryotinia fuckeliana BcDW1] Length = 172 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/60 (50%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 5 SVVVLISGSVIYW-KDNEEGETRGFTETVVLVPNPEASSKSAKGKVRKWSILSQNFRLIL 181 S+ +++SG V Y K+ +EGE RGF E VLVPN EA + A ++KW I SQ FRL+L Sbjct: 113 SIAIMVSGQVKYTSKNGDEGEERGFMENFVLVPNVEARNPKAPKGIKKWLIQSQIFRLVL 172 >ref|XP_001559620.1| hypothetical protein BC1G_01776 [Botryotinia fuckeliana B05.10] Length = 172 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/60 (50%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 5 SVVVLISGSVIYW-KDNEEGETRGFTETVVLVPNPEASSKSAKGKVRKWSILSQNFRLIL 181 S+ +++SG V Y K+ +EGE RGF E VLVPN EA + A ++KW I SQ FRL+L Sbjct: 113 SIAIMVSGQVKYTSKNGDEGEERGFMENFVLVPNVEARNPKAPKGIKKWLIQSQIFRLVL 172 >ref|XP_001587156.1| hypothetical protein SS1G_12186 [Sclerotinia sclerotiorum 1980] gi|154696242|gb|EDN95980.1| hypothetical protein SS1G_12186 [Sclerotinia sclerotiorum 1980 UF-70] Length = 172 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/60 (50%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 5 SVVVLISGSVIYW-KDNEEGETRGFTETVVLVPNPEASSKSAKGKVRKWSILSQNFRLIL 181 S+ +++SG V Y K+ +EGE RGF E VLVPN EA + A +R+W I SQ FRL+L Sbjct: 113 SIAIMVSGQVKYSSKNGDEGEERGFMENFVLVPNLEARNPKASKGIRRWLIQSQVFRLVL 172