BLASTX nr result
ID: Mentha22_contig00051423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00051423 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35663.1| hypothetical protein MIMGU_mgv1a000286mg [Mimulus... 85 1e-14 >gb|EYU35663.1| hypothetical protein MIMGU_mgv1a000286mg [Mimulus guttatus] Length = 1297 Score = 84.7 bits (208), Expect = 1e-14 Identities = 55/108 (50%), Positives = 63/108 (58%) Frame = -3 Query: 324 EGSDDTAPLIEERSRETELIDEGEKFGVERELGELRFKEKSEWIEEKLTNGDVRDDDDHL 145 E D +APLIEERSRE E +EGE + R L LR+K+K DD+ L Sbjct: 129 EHPDFSAPLIEERSREIES-NEGEIWEEHRGLEGLRYKQKM--------------DDEFL 173 Query: 144 DFSDAKVNGELLGSDDEKSDAESFDSEKVNVDSLDSPPHSPWARVVER 1 D SDDEKS+A+SFDSE VNVDSLDSPP SPW RV ER Sbjct: 174 D-----------RSDDEKSEADSFDSEMVNVDSLDSPPRSPWTRVEER 210