BLASTX nr result
ID: Mentha22_contig00051069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00051069 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532343.1| LIGULELESS1 protein, putative [Ricinus commu... 57 2e-06 >ref|XP_002532343.1| LIGULELESS1 protein, putative [Ricinus communis] gi|223527960|gb|EEF30045.1| LIGULELESS1 protein, putative [Ricinus communis] Length = 349 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/75 (42%), Positives = 40/75 (53%), Gaps = 6/75 (8%) Frame = -1 Query: 403 NKPWGSRSQASDLGVHTTNGAVGV------DNSSAPFSRYSCPSWEFEGDEGGHSLHEMP 242 N+PWGSR+QAS LGV G + A ++Y PSW F+G E G S HEM Sbjct: 240 NQPWGSRNQASGLGVKNLVDPQGAPLAQSTNPHGAAVNQYPNPSWGFKGSEAGSSSHEMC 299 Query: 241 SDMGPPQISHSHSTH 197 D+G QIS + H Sbjct: 300 PDLGLGQISQPPNGH 314