BLASTX nr result
ID: Mentha22_contig00050942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050942 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202494.1| hypothetical protein PRUPE_ppa010620mg [Prun... 65 8e-09 gb|EYU27250.1| hypothetical protein MIMGU_mgv1a012777mg [Mimulus... 57 2e-06 gb|AFK44105.1| unknown [Lotus japonicus] 57 2e-06 ref|XP_003525291.1| PREDICTED: derlin-1-like isoform X1 [Glycine... 57 2e-06 ref|XP_003630693.1| Derlin-1 [Medicago truncatula] gi|355524715|... 57 2e-06 ref|XP_006580484.1| PREDICTED: derlin-1-like isoform X2 [Glycine... 57 3e-06 ref|XP_006284337.1| hypothetical protein CARUB_v10005507mg [Caps... 57 3e-06 ref|XP_002266291.2| PREDICTED: LOW QUALITY PROTEIN: derlin-1.2-l... 57 3e-06 emb|CBI38648.3| unnamed protein product [Vitis vinifera] 57 3e-06 emb|CBI38645.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002266374.1| PREDICTED: derlin-1.1-like [Vitis vinifera] 57 3e-06 emb|CAN79229.1| hypothetical protein VITISV_027074 [Vitis vinifera] 57 3e-06 ref|XP_007160273.1| hypothetical protein PHAVU_002G307400g [Phas... 57 4e-06 gb|EXC28689.1| hypothetical protein L484_006985 [Morus notabilis] 56 5e-06 ref|XP_003630694.1| Derlin-1 [Medicago truncatula] gi|355524716|... 56 5e-06 gb|EPS66230.1| hypothetical protein M569_08547, partial [Genlise... 56 6e-06 ref|XP_007202495.1| hypothetical protein PRUPE_ppa010620mg [Prun... 56 6e-06 ref|XP_003530537.1| PREDICTED: derlin-1-like [Glycine max] 56 6e-06 gb|ACU23590.1| unknown [Glycine max] 56 6e-06 ref|XP_004287492.1| PREDICTED: derlin-1-like [Fragaria vesca sub... 55 8e-06 >ref|XP_007202494.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica] gi|462398025|gb|EMJ03693.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica] Length = 214 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLYPYF 97 IAGHLYYFLTVLHPLAGGKNIL+TP ++YPYF Sbjct: 177 IAGHLYYFLTVLHPLAGGKNILQTPRWVYPYF 208 >gb|EYU27250.1| hypothetical protein MIMGU_mgv1a012777mg [Mimulus guttatus] Length = 240 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFL 85 IAGHLYYFLTVLHPLAGG+NILKTP F+ Sbjct: 177 IAGHLYYFLTVLHPLAGGRNILKTPYFI 204 >gb|AFK44105.1| unknown [Lotus japonicus] Length = 246 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 IAGHLYYFLTVLHPLAGGKNILKTP +++ Sbjct: 177 IAGHLYYFLTVLHPLAGGKNILKTPMWVH 205 >ref|XP_003525291.1| PREDICTED: derlin-1-like isoform X1 [Glycine max] Length = 246 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 IAGHLYYFLTVLHPLAGGKNILKTP +++ Sbjct: 177 IAGHLYYFLTVLHPLAGGKNILKTPMWVH 205 >ref|XP_003630693.1| Derlin-1 [Medicago truncatula] gi|355524715|gb|AET05169.1| Derlin-1 [Medicago truncatula] gi|388496922|gb|AFK36527.1| unknown [Medicago truncatula] Length = 245 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 IAGHLYYFLTVLHPLAGGKNILKTP +++ Sbjct: 177 IAGHLYYFLTVLHPLAGGKNILKTPMWVH 205 >ref|XP_006580484.1| PREDICTED: derlin-1-like isoform X2 [Glycine max] Length = 219 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLYPYFLPVHILFQIS 127 IAGHLYYFLTVLHPLAGGKNILKTP ++ P +L S Sbjct: 177 IAGHLYYFLTVLHPLAGGKNILKTPMWVIVGAGPTAVLLFFS 218 >ref|XP_006284337.1| hypothetical protein CARUB_v10005507mg [Capsella rubella] gi|482553042|gb|EOA17235.1| hypothetical protein CARUB_v10005507mg [Capsella rubella] Length = 206 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLYP 91 IAGHLYYFLTVLHPLA GKN LKTP ++YP Sbjct: 177 IAGHLYYFLTVLHPLATGKNYLKTPKWVYP 206 >ref|XP_002266291.2| PREDICTED: LOW QUALITY PROTEIN: derlin-1.2-like [Vitis vinifera] Length = 273 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 +AGHLYYFLTVLHPLAGGKNILKTP +++ Sbjct: 177 VAGHLYYFLTVLHPLAGGKNILKTPLWVH 205 >emb|CBI38648.3| unnamed protein product [Vitis vinifera] Length = 327 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 +AGHLYYFLTVLHPLAGGKNILKTP +++ Sbjct: 228 VAGHLYYFLTVLHPLAGGKNILKTPLWVH 256 >emb|CBI38645.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 +AGHLYYFLTVLHPLAGGKNILKTP +++ Sbjct: 260 VAGHLYYFLTVLHPLAGGKNILKTPLWVH 288 >ref|XP_002266374.1| PREDICTED: derlin-1.1-like [Vitis vinifera] Length = 276 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 +AGHLYYFLTVLHPLAGGKNILKTP +++ Sbjct: 177 VAGHLYYFLTVLHPLAGGKNILKTPLWVH 205 >emb|CAN79229.1| hypothetical protein VITISV_027074 [Vitis vinifera] Length = 281 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 +AGHLYYFLTVLHPLAGGKNILKTP +++ Sbjct: 182 VAGHLYYFLTVLHPLAGGKNILKTPLWVH 210 >ref|XP_007160273.1| hypothetical protein PHAVU_002G307400g [Phaseolus vulgaris] gi|561033688|gb|ESW32267.1| hypothetical protein PHAVU_002G307400g [Phaseolus vulgaris] Length = 246 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFL 85 IAGHLYYFLTVLHPLAGGKNILKTP ++ Sbjct: 177 IAGHLYYFLTVLHPLAGGKNILKTPMWV 204 >gb|EXC28689.1| hypothetical protein L484_006985 [Morus notabilis] Length = 236 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTP 76 IAGHLYYFLTVLHPLAGGKNILKTP Sbjct: 174 IAGHLYYFLTVLHPLAGGKNILKTP 198 >ref|XP_003630694.1| Derlin-1 [Medicago truncatula] gi|355524716|gb|AET05170.1| Derlin-1 [Medicago truncatula] Length = 204 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTP 76 IAGHLYYFLTVLHPLAGGKNILKTP Sbjct: 177 IAGHLYYFLTVLHPLAGGKNILKTP 201 >gb|EPS66230.1| hypothetical protein M569_08547, partial [Genlisea aurea] Length = 236 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 +AGHLYYFLTVLHPL+GG NILKTPA ++ Sbjct: 171 VAGHLYYFLTVLHPLSGGSNILKTPALIH 199 >ref|XP_007202495.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica] gi|462398026|gb|EMJ03694.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica] Length = 242 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 IAGHLYYFLTVLHPLAGGKNIL+TP +++ Sbjct: 177 IAGHLYYFLTVLHPLAGGKNILQTPRWVH 205 >ref|XP_003530537.1| PREDICTED: derlin-1-like [Glycine max] Length = 246 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 IAGHLYYF TVLHPLAGGKNILKTP +++ Sbjct: 177 IAGHLYYFFTVLHPLAGGKNILKTPMWVH 205 >gb|ACU23590.1| unknown [Glycine max] Length = 172 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 IAGHLYYF TVLHPLAGGKNILKTP +++ Sbjct: 103 IAGHLYYFFTVLHPLAGGKNILKTPMWVH 131 >ref|XP_004287492.1| PREDICTED: derlin-1-like [Fragaria vesca subsp. vesca] Length = 247 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 2 IAGHLYYFLTVLHPLAGGKNILKTPAFLY 88 IAGHLY+FLTVLHPLAGGKNILKTP +++ Sbjct: 177 IAGHLYHFLTVLHPLAGGKNILKTPRWVH 205