BLASTX nr result
ID: Mentha22_contig00050705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050705 (561 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74001.1| hypothetical protein M569_00754 [Genlisea aurea] 106 5e-21 ref|XP_006349130.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_004251011.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 emb|CBI32449.3| unnamed protein product [Vitis vinifera] 97 3e-18 ref|XP_002281969.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-18 gb|EXB63557.1| Pentatricopeptide repeat-containing protein [Moru... 95 1e-17 ref|XP_002521838.1| pentatricopeptide repeat-containing protein,... 94 3e-17 ref|XP_004292454.1| PREDICTED: pentatricopeptide repeat-containi... 93 4e-17 ref|XP_007042348.1| Pentatricopeptide repeat-containing protein ... 92 1e-16 ref|XP_003607061.1| Pentatricopeptide repeat-containing protein,... 92 1e-16 ref|XP_003589556.1| Pentatricopeptide repeat-containing protein ... 92 1e-16 ref|XP_003588289.1| Pentatricopeptide repeat-containing protein ... 92 1e-16 ref|XP_006480143.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_006423076.1| hypothetical protein CICLE_v10027854mg [Citr... 91 2e-16 ref|XP_007201413.1| hypothetical protein PRUPE_ppa001679mg [Prun... 91 3e-16 ref|XP_004499305.1| PREDICTED: pentatricopeptide repeat-containi... 90 5e-16 gb|AFW72980.1| hypothetical protein ZEAMMB73_593295 [Zea mays] 90 5e-16 ref|XP_003570175.1| PREDICTED: pentatricopeptide repeat-containi... 89 6e-16 gb|ADB85413.1| putative endonuclease [Phyllostachys edulis] 89 6e-16 ref|XP_002454427.1| hypothetical protein SORBIDRAFT_04g030740 [S... 89 6e-16 >gb|EPS74001.1| hypothetical protein M569_00754 [Genlisea aurea] Length = 850 Score = 106 bits (264), Expect = 5e-21 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = -2 Query: 176 LAELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 L +LKR SP VEVKELEELPEQWRR++LAWLCKELPAHRSATF+R+LNAQRKWIRQ+ Sbjct: 150 LNDLKRRESPTVEVKELEELPEQWRRAKLAWLCKELPAHRSATFIRVLNAQRKWIRQE 207 >ref|XP_006349130.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like, partial [Solanum tuberosum] Length = 813 Score = 100 bits (249), Expect = 3e-19 Identities = 43/56 (76%), Positives = 53/56 (94%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 ELK+F +PAVEV+ELE++P+QWRR+RLAWLCKELPAH++ T VRILNAQRKWIRQ+ Sbjct: 112 ELKKFETPAVEVRELEDIPDQWRRARLAWLCKELPAHKTPTMVRILNAQRKWIRQE 167 >ref|XP_004251011.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Solanum lycopersicum] Length = 816 Score = 98.6 bits (244), Expect = 1e-18 Identities = 41/56 (73%), Positives = 52/56 (92%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 ELK+F +P++EV+ELE++P+QWRR+RLAWLCKELPAHR+ T VRILNAQRKW RQ+ Sbjct: 112 ELKKFETPSIEVRELEDIPDQWRRARLAWLCKELPAHRTPTMVRILNAQRKWFRQE 167 >emb|CBI32449.3| unnamed protein product [Vitis vinifera] Length = 790 Score = 97.1 bits (240), Expect = 3e-18 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 +L+ SP++EVKELEELPEQWRRS+LAWLCKELPAH+ AT +RILNAQ+KW+RQ+ Sbjct: 98 DLRHLSSPSLEVKELEELPEQWRRSKLAWLCKELPAHKPATLIRILNAQKKWVRQE 153 >ref|XP_002281969.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Vitis vinifera] Length = 823 Score = 97.1 bits (240), Expect = 3e-18 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 +L+ SP++EVKELEELPEQWRRS+LAWLCKELPAH+ AT +RILNAQ+KW+RQ+ Sbjct: 131 DLRHLSSPSLEVKELEELPEQWRRSKLAWLCKELPAHKPATLIRILNAQKKWVRQE 186 >gb|EXB63557.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 823 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -2 Query: 173 AELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 ++LK +P +EVKELEELPEQWRRSRLAWLCKELPAH+ T VRILNAQRKW+ Q+ Sbjct: 121 SDLKHLAAPKLEVKELEELPEQWRRSRLAWLCKELPAHKPGTMVRILNAQRKWLTQE 177 >ref|XP_002521838.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538876|gb|EEF40474.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 835 Score = 93.6 bits (231), Expect = 3e-17 Identities = 39/56 (69%), Positives = 51/56 (91%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 +LK +PA+EVKEL+ELPEQWRR+RLAWLCK+LPAH++ T V+ILNAQ+KW+RQ+ Sbjct: 142 DLKHLDTPALEVKELQELPEQWRRARLAWLCKQLPAHKAGTLVKILNAQKKWMRQE 197 >ref|XP_004292454.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Fragaria vesca subsp. vesca] Length = 794 Score = 93.2 bits (230), Expect = 4e-17 Identities = 39/56 (69%), Positives = 50/56 (89%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 +LK SP +EV+EL+ELPEQWRRS+LAWLCKELP+H+S T +RILNAQ+KW+RQ+ Sbjct: 92 DLKHLASPKLEVRELDELPEQWRRSKLAWLCKELPSHKSGTLIRILNAQKKWMRQE 147 >ref|XP_007042348.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508706283|gb|EOX98179.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 823 Score = 91.7 bits (226), Expect = 1e-16 Identities = 39/56 (69%), Positives = 49/56 (87%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 ++K +P +EVKELEELPE WRRS+LAWLCKELPAH++ T VRILNAQ+KW+RQ+ Sbjct: 123 DMKHLVAPEMEVKELEELPEHWRRSKLAWLCKELPAHKAGTLVRILNAQKKWMRQE 178 >ref|XP_003607061.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] gi|355508116|gb|AES89258.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] Length = 767 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 E +R P VEVKEL E+PE WRRSR+AWLCKELPAH++ T +RILNAQRKW+RQD Sbjct: 100 EKRRLPRPEVEVKELSEVPELWRRSRVAWLCKELPAHKAGTLIRILNAQRKWLRQD 155 >ref|XP_003589556.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355478604|gb|AES59807.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 761 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 E +R P VEVKEL E+PE WRRSR+AWLCKELPAH++ T +RILNAQRKW+RQD Sbjct: 100 EKRRLPRPEVEVKELSEVPELWRRSRVAWLCKELPAHKAGTLIRILNAQRKWLRQD 155 >ref|XP_003588289.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|357469333|ref|XP_003604951.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|357520985|ref|XP_003630781.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477337|gb|AES58540.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355506006|gb|AES87148.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524803|gb|AET05257.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 775 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = -2 Query: 170 ELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 E +R P VEVKEL E+PE WRRSR+AWLCKELPAH++ T +RILNAQRKW+RQD Sbjct: 100 EKRRLPRPEVEVKELSEVPELWRRSRVAWLCKELPAHKAGTLIRILNAQRKWLRQD 155 >ref|XP_006480143.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Citrus sinensis] Length = 787 Score = 91.3 bits (225), Expect = 2e-16 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 2/113 (1%) Frame = -2 Query: 335 FSSSPVSTGKTVSGISEEGEANNYDLPEEGKGNYYDSFRXXXXXXXXXXXXXELA--ELK 162 F S+P+S+ + S E+ A D +E K +D F+ A E++ Sbjct: 37 FLSAPLSSATSQSTFVEQ-LAGEKDSSQEEK---WDMFKNSDAESGSVDFDVGTAGSEMR 92 Query: 161 RFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 P VEV ELEELPEQWRR++LAWLCKELP+H+ T VRILNAQ+KW+RQ+ Sbjct: 93 HLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQE 145 >ref|XP_006423076.1| hypothetical protein CICLE_v10027854mg [Citrus clementina] gi|557525010|gb|ESR36316.1| hypothetical protein CICLE_v10027854mg [Citrus clementina] Length = 787 Score = 91.3 bits (225), Expect = 2e-16 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 2/113 (1%) Frame = -2 Query: 335 FSSSPVSTGKTVSGISEEGEANNYDLPEEGKGNYYDSFRXXXXXXXXXXXXXELA--ELK 162 F S+P+S+ + S E+ A D +E K +D F+ A E++ Sbjct: 37 FLSAPLSSAASQSTFVEQ-LAGEKDSSQEEK---WDMFKNSDAESGSVDFDVGAAGSEMR 92 Query: 161 RFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 P VEV ELEELPEQWRR++LAWLCKELP+H+ T VRILNAQ+KW+RQ+ Sbjct: 93 HLGEPVVEVIELEELPEQWRRAKLAWLCKELPSHKGGTLVRILNAQKKWLRQE 145 >ref|XP_007201413.1| hypothetical protein PRUPE_ppa001679mg [Prunus persica] gi|462396813|gb|EMJ02612.1| hypothetical protein PRUPE_ppa001679mg [Prunus persica] Length = 781 Score = 90.5 bits (223), Expect = 3e-16 Identities = 50/120 (41%), Positives = 67/120 (55%) Frame = -2 Query: 362 PYRKFPLPIFSSSPVSTGKTVSGISEEGEANNYDLPEEGKGNYYDSFRXXXXXXXXXXXX 183 P +FP PI S P++ N+DL +G ++ + Sbjct: 60 PTHRFPRPI-SGFPLAVAA-----KSRRPGENWDLSNVAQGEAFNLDKCFSS-------- 105 Query: 182 XELAELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 A+LK P +EV ELE+LPEQWRRS+LAWLCKELPAH++ T RILNAQ+KW+RQ+ Sbjct: 106 ---ADLKHLAVPELEVPELEDLPEQWRRSKLAWLCKELPAHKAGTLSRILNAQKKWMRQE 162 >ref|XP_004499305.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like isoform X1 [Cicer arietinum] Length = 793 Score = 89.7 bits (221), Expect = 5e-16 Identities = 40/57 (70%), Positives = 46/57 (80%) Frame = -2 Query: 173 AELKRFHSPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 A+ KR P VEV EL E+PE WRRSR+AWLCKELPAH + T +RILNAQRKW+RQD Sbjct: 104 ADEKRLPRPEVEVMELNEVPELWRRSRVAWLCKELPAHNAGTLIRILNAQRKWLRQD 160 >gb|AFW72980.1| hypothetical protein ZEAMMB73_593295 [Zea mays] Length = 783 Score = 89.7 bits (221), Expect = 5e-16 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -2 Query: 152 SPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 SP +EV ELEELPEQWRRSR+AWLCKELPA++ +TF RILNAQRKWI QD Sbjct: 92 SPELEVFELEELPEQWRRSRIAWLCKELPAYKHSTFTRILNAQRKWINQD 141 >ref|XP_003570175.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Brachypodium distachyon] Length = 787 Score = 89.4 bits (220), Expect = 6e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -2 Query: 152 SPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 SP +EV ELEELPEQWRRSR+AWLCKELPA++ +TF RILNAQRKW+ QD Sbjct: 96 SPELEVPELEELPEQWRRSRIAWLCKELPAYKHSTFTRILNAQRKWLTQD 145 >gb|ADB85413.1| putative endonuclease [Phyllostachys edulis] Length = 787 Score = 89.4 bits (220), Expect = 6e-16 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -2 Query: 152 SPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 SP +EV ELEELPEQWRRSR+AWLCKELPA++ +TF RILNAQRKW+ QD Sbjct: 96 SPELEVPELEELPEQWRRSRIAWLCKELPAYKHSTFTRILNAQRKWLTQD 145 >ref|XP_002454427.1| hypothetical protein SORBIDRAFT_04g030740 [Sorghum bicolor] gi|241934258|gb|EES07403.1| hypothetical protein SORBIDRAFT_04g030740 [Sorghum bicolor] Length = 794 Score = 89.4 bits (220), Expect = 6e-16 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -2 Query: 152 SPAVEVKELEELPEQWRRSRLAWLCKELPAHRSATFVRILNAQRKWIRQD 3 SP +EV ELEELPEQWRRSR+AWLCKELPA++ +TF RILNAQRKWI QD Sbjct: 103 SPELEVFELEELPEQWRRSRIAWLCKELPAYKHSTFTRILNAQRKWITQD 152