BLASTX nr result
ID: Mentha22_contig00050680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050680 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27139.1| hypothetical protein MIMGU_mgv1a018142mg, partial... 98 1e-18 gb|EYU27137.1| hypothetical protein MIMGU_mgv1a0206321mg, partia... 92 7e-17 dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] 83 5e-14 gb|AEI52549.1| cysteine/histidine-rich DC1 domain protein [Capsi... 82 8e-14 ref|XP_006369466.1| DC1 domain-containing family protein [Populu... 80 2e-13 ref|XP_006295416.1| hypothetical protein CARUB_v10024514mg [Caps... 72 1e-10 ref|XP_002512181.1| protein binding protein, putative [Ricinus c... 71 2e-10 ref|XP_006397613.1| hypothetical protein EUTSA_v10001601mg [Eutr... 70 3e-10 ref|XP_006295388.1| hypothetical protein CARUB_v10024483mg [Caps... 70 4e-10 ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing pr... 69 5e-10 ref|XP_004229344.1| PREDICTED: uncharacterized protein LOC101249... 69 7e-10 gb|EYU27129.1| hypothetical protein MIMGU_mgv1a020238mg, partial... 69 9e-10 ref|XP_006298947.1| hypothetical protein CARUB_v10015072mg [Caps... 68 1e-09 ref|XP_006377073.1| hypothetical protein POPTR_0012s13310g, part... 68 2e-09 ref|XP_006387043.1| hypothetical protein POPTR_2065s00200g, part... 67 3e-09 ref|NP_181965.1| cysteine/histidine-rich C1 domain-containing pr... 67 3e-09 ref|XP_006359175.1| PREDICTED: uncharacterized protein LOC102603... 66 4e-09 ref|XP_006295592.1| hypothetical protein CARUB_v10024700mg [Caps... 66 4e-09 ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [... 66 4e-09 pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thal... 66 4e-09 >gb|EYU27139.1| hypothetical protein MIMGU_mgv1a018142mg, partial [Mimulus guttatus] Length = 408 Score = 97.8 bits (242), Expect = 1e-18 Identities = 42/73 (57%), Positives = 53/73 (72%) Frame = -3 Query: 221 NTIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPRE 42 N IKHFSHPH LK ME + + K+CSACE++L+G+AYCCT+ C F+L K CFDAP + Sbjct: 225 NLIKHFSHPHGLKGMEI--KKKNAKVCSACEIELNGAAYCCTESQCNFNLHKTCFDAPLK 282 Query: 41 VRHNFHPAHSLAL 3 +RH HP H L L Sbjct: 283 LRHKSHPEHPLTL 295 >gb|EYU27137.1| hypothetical protein MIMGU_mgv1a0206321mg, partial [Mimulus guttatus] Length = 317 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/70 (58%), Positives = 49/70 (70%) Frame = -3 Query: 212 KHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREVRH 33 KHFSHPH L ME E E K+CSACE++L+G+AYCCT+ C+F+L K CFDAPRE H Sbjct: 115 KHFSHPHVLNGMEI--ETENAKVCSACEIELTGAAYCCTESQCSFNLHKTCFDAPREFPH 172 Query: 32 NFHPAHSLAL 3 H H L L Sbjct: 173 KSHLEHPLTL 182 >dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] Length = 236 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/71 (53%), Positives = 47/71 (66%) Frame = -3 Query: 215 IKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREVR 36 +KHFSHPH L+ E E ICS CE KLSG +Y CT+P C F+L K CF+ PR+++ Sbjct: 1 MKHFSHPHALELSEVQETNEI--ICSGCENKLSGISYKCTKPNCKFTLHKSCFELPRKIQ 58 Query: 35 HNFHPAHSLAL 3 HN HP H L L Sbjct: 59 HNSHPNHPLTL 69 >gb|AEI52549.1| cysteine/histidine-rich DC1 domain protein [Capsicum annuum] Length = 233 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/71 (52%), Positives = 47/71 (66%) Frame = -3 Query: 215 IKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREVR 36 +KHFSHPH L+ E ET +CS CE KL G++Y CT+P C FSL K CF+ PR+++ Sbjct: 1 MKHFSHPHALELSEVQQSNET--VCSGCENKLCGTSYKCTKPNCEFSLHKSCFELPRKIQ 58 Query: 35 HNFHPAHSLAL 3 HN H H L L Sbjct: 59 HNSHLKHPLTL 69 >ref|XP_006369466.1| DC1 domain-containing family protein [Populus trichocarpa] gi|550348015|gb|ERP66035.1| DC1 domain-containing family protein [Populus trichocarpa] Length = 190 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/71 (52%), Positives = 46/71 (64%) Frame = -3 Query: 215 IKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREVR 36 +KHFSH H L+ ++ E E+ ICS CE+ LSGSAY CT+ C F L K CF+ PRE+ Sbjct: 17 VKHFSHSHPLRPVDVKEEEES--ICSGCELDLSGSAYKCTKSTCDFFLHKSCFELPRELE 74 Query: 35 HNFHPAHSLAL 3 H HP H L L Sbjct: 75 HTSHPQHLLVL 85 >ref|XP_006295416.1| hypothetical protein CARUB_v10024514mg [Capsella rubella] gi|482564124|gb|EOA28314.1| hypothetical protein CARUB_v10024514mg [Capsella rubella] Length = 239 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/72 (45%), Positives = 45/72 (62%) Frame = -3 Query: 218 TIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREV 39 +++H SH H L+ + GE E ICS CE++L+G A+ C + C + L K CFD PRE+ Sbjct: 11 SVRHPSHTHPLRVCKARGEDEM--ICSGCELELTGQAFKCAKSDCDYFLHKSCFDLPREL 68 Query: 38 RHNFHPAHSLAL 3 H HP HSL L Sbjct: 69 SHKSHPDHSLTL 80 >ref|XP_002512181.1| protein binding protein, putative [Ricinus communis] gi|223548725|gb|EEF50215.1| protein binding protein, putative [Ricinus communis] Length = 187 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/71 (45%), Positives = 44/71 (61%) Frame = -3 Query: 215 IKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREVR 36 +KHFSH H L+ + + E IC CE+ LSGSAY C++ C F L K CF+ P+E++ Sbjct: 16 VKHFSHSHPLRPADVKEDEEI--ICFGCELDLSGSAYKCSKSKCVFLLHKSCFELPKELQ 73 Query: 35 HNFHPAHSLAL 3 H+ H H L L Sbjct: 74 HDSHSEHLLTL 84 >ref|XP_006397613.1| hypothetical protein EUTSA_v10001601mg [Eutrema salsugineum] gi|557098686|gb|ESQ39066.1| hypothetical protein EUTSA_v10001601mg [Eutrema salsugineum] Length = 248 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/72 (44%), Positives = 44/72 (61%) Frame = -3 Query: 218 TIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREV 39 +++H SH H L+ + E E ICS CE+ L+G+A+ CT+ C + L K CF+ PRE Sbjct: 7 SVRHPSHSHPLRSHKAQVEEEI--ICSGCELDLTGAAFKCTKSECDYFLHKSCFELPRET 64 Query: 38 RHNFHPAHSLAL 3 RH HP H L L Sbjct: 65 RHKAHPDHPLTL 76 >ref|XP_006295388.1| hypothetical protein CARUB_v10024483mg [Capsella rubella] gi|482564096|gb|EOA28286.1| hypothetical protein CARUB_v10024483mg [Capsella rubella] Length = 246 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/72 (44%), Positives = 43/72 (59%) Frame = -3 Query: 218 TIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREV 39 +++H SH H L + G+ E +CS CE++L+G A+ C + C F L K CFD PRE Sbjct: 11 SVRHPSHNHPLNIFKARGKDEV--VCSGCELELTGQAFKCMKSDCDFFLHKSCFDLPRET 68 Query: 38 RHNFHPAHSLAL 3 H HP HSL L Sbjct: 69 NHKSHPDHSLTL 80 >ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128201|gb|AAC16105.1| unknown protein [Arabidopsis thaliana] gi|37202108|gb|AAQ89669.1| At2g44380 [Arabidopsis thaliana] gi|51971661|dbj|BAD44495.1| unknown protein [Arabidopsis thaliana] gi|330255320|gb|AEC10414.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 247 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/72 (43%), Positives = 43/72 (59%) Frame = -3 Query: 218 TIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREV 39 +++H SH H L+ + E E +CS CE++L+G A+ C + C + L K CFD PRE Sbjct: 11 SVRHASHNHPLRVFKARDEDEV--VCSGCELELTGQAFKCMKSDCDYFLHKSCFDLPRET 68 Query: 38 RHNFHPAHSLAL 3 H HP HSL L Sbjct: 69 NHKSHPNHSLTL 80 >ref|XP_004229344.1| PREDICTED: uncharacterized protein LOC101249575 [Solanum lycopersicum] Length = 236 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/72 (48%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = -3 Query: 215 IKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSA-YCCTQPYCTFSLDKGCFDAPREV 39 +KHFSHPH L E E ICS CE KL G+ Y CT+ C F+L K CF+ PR++ Sbjct: 1 MKHFSHPHALAIFEVQESNEI--ICSGCENKLCGTTNYKCTKSNCEFTLHKSCFELPRKI 58 Query: 38 RHNFHPAHSLAL 3 HN H H L L Sbjct: 59 LHNSHRDHPLTL 70 >gb|EYU27129.1| hypothetical protein MIMGU_mgv1a020238mg, partial [Mimulus guttatus] Length = 187 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/70 (50%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = -3 Query: 209 HFSHPHNLKQMEFDGEAETPKICSACEVKL-SGSAYCCTQPYCTFSLDKGCFDAPREVRH 33 HFSH H L+ E E ICS CE + SGSAY C +P C F L CFD PR +RH Sbjct: 29 HFSHRHPLELSEVHEEDHA--ICSGCEHDIISGSAYICAKPKCNFLLHDLCFDLPRRIRH 86 Query: 32 NFHPAHSLAL 3 HP H L+L Sbjct: 87 RCHPKHPLSL 96 >ref|XP_006298947.1| hypothetical protein CARUB_v10015072mg [Capsella rubella] gi|482567656|gb|EOA31845.1| hypothetical protein CARUB_v10015072mg [Capsella rubella] Length = 244 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/72 (41%), Positives = 44/72 (61%) Frame = -3 Query: 218 TIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREV 39 +++H SH H L+ + +AE ICS C++ L G+++ CT+ C + L K C D PRE+ Sbjct: 7 SVRHPSHNHPLRG--YKAQAEDEIICSGCDLNLIGASFKCTKSDCDYFLHKSCLDLPREI 64 Query: 38 RHNFHPAHSLAL 3 RH HP H L L Sbjct: 65 RHKSHPNHPLTL 76 >ref|XP_006377073.1| hypothetical protein POPTR_0012s13310g, partial [Populus trichocarpa] gi|550327041|gb|ERP54870.1| hypothetical protein POPTR_0012s13310g, partial [Populus trichocarpa] Length = 305 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/69 (47%), Positives = 42/69 (60%) Frame = -3 Query: 209 HFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREVRHN 30 HF+H H L E E E CS C SG AY C++ C+F LDK CF+ PR+++HN Sbjct: 146 HFTHGHPLTLTEIKDEDEIS--CSTCGRCCSGPAYDCSK--CSFILDKSCFELPRKIQHN 201 Query: 29 FHPAHSLAL 3 FHP+H L L Sbjct: 202 FHPSHPLTL 210 >ref|XP_006387043.1| hypothetical protein POPTR_2065s00200g, partial [Populus trichocarpa] gi|550304432|gb|ERP45957.1| hypothetical protein POPTR_2065s00200g, partial [Populus trichocarpa] Length = 208 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/69 (49%), Positives = 42/69 (60%) Frame = -3 Query: 209 HFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREVRHN 30 HF++ H L E E E CSAC SG AY C++ C+F LDK CF+ PRE++HN Sbjct: 136 HFTNGHPLTLTEIKDEDEIS--CSACGRCCSGPAYDCSK--CSFILDKSCFELPREIQHN 191 Query: 29 FHPAHSLAL 3 FHP H L L Sbjct: 192 FHPNHPLTL 200 >ref|NP_181965.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128200|gb|AAC16104.1| unknown protein [Arabidopsis thaliana] gi|40822978|gb|AAR92250.1| At2g44370 [Arabidopsis thaliana] gi|45752684|gb|AAS76240.1| At2g44370 [Arabidopsis thaliana] gi|330255319|gb|AEC10413.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 250 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/72 (43%), Positives = 43/72 (59%) Frame = -3 Query: 218 TIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREV 39 +++H SH H L+ + E E ICS C++ L G+A+ CT+ C + L K CF+ PRE Sbjct: 7 SVRHPSHNHPLRSHKAQVEEEI--ICSGCDLDLIGAAFKCTKSECDYFLHKSCFELPRET 64 Query: 38 RHNFHPAHSLAL 3 RH HP H L L Sbjct: 65 RHKAHPDHPLIL 76 >ref|XP_006359175.1| PREDICTED: uncharacterized protein LOC102603106 [Solanum tuberosum] Length = 191 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = -3 Query: 209 HFSHPHNLKQMEFDGEAETPKICSACEVKLSGS-AYCCTQPYCTFSLDKGCFDAPREVRH 33 HFSH H L ++ + E ICS CE LS AY CT+ C F L CFD PR+++H Sbjct: 11 HFSHGHPLIKISDILDEEDQVICSGCEHHLSSEPAYMCTKINCNFILHDSCFDLPRQIKH 70 Query: 32 NFHPAHSLAL 3 HP H+L+L Sbjct: 71 KSHPKHTLSL 80 >ref|XP_006295592.1| hypothetical protein CARUB_v10024700mg [Capsella rubella] gi|482564300|gb|EOA28490.1| hypothetical protein CARUB_v10024700mg [Capsella rubella] Length = 251 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/72 (41%), Positives = 43/72 (59%) Frame = -3 Query: 218 TIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREV 39 +++H SH H L+ + E E ICS C++ L G+++ CT+ C + L K CF+ PRE Sbjct: 7 SVRHPSHNHPLRSHKAQVEEEI--ICSGCDLDLVGASFKCTKSECDYFLHKSCFELPRET 64 Query: 38 RHNFHPAHSLAL 3 RH HP H L L Sbjct: 65 RHKAHPDHPLTL 76 >ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus] gi|449524190|ref|XP_004169106.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus] Length = 179 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 3/73 (4%) Frame = -3 Query: 212 KHFSHPHNLKQ---MEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPRE 42 +HFSHPH L +E DG +CSACE LSG+A+ C++P C F L CF P E Sbjct: 4 QHFSHPHPLAAATLVEDDGT-----LCSACEFPLSGAAFKCSKPKCEFHLHDLCFALPPE 58 Query: 41 VRHNFHPAHSLAL 3 + H HP H L L Sbjct: 59 IHHPSHPKHPLIL 71 >pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thaliana Length = 457 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/72 (43%), Positives = 43/72 (59%) Frame = -3 Query: 218 TIKHFSHPHNLKQMEFDGEAETPKICSACEVKLSGSAYCCTQPYCTFSLDKGCFDAPREV 39 +++H SH H L+ + E E ICS C++ L G+ + CT+ C + L K CFD PRE+ Sbjct: 215 SVRHPSHNHPLRGHKAQVEDEI--ICSGCDLDLLGAYFKCTKSECDYFLHKSCFDLPREI 272 Query: 38 RHNFHPAHSLAL 3 RH HP H L L Sbjct: 273 RHKSHPDHPLIL 284