BLASTX nr result
ID: Mentha22_contig00049919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00049919 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU98179.1| unnamed protein product [Malassezia sympodialis ... 56 5e-06 >emb|CCU98179.1| unnamed protein product [Malassezia sympodialis ATCC 42132] Length = 392 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/79 (32%), Positives = 42/79 (53%) Frame = +3 Query: 141 RPTRKVGCPAKIKAHKLFSSDTVFVTHHKSHMGHGINDLQTWTSSRMSPATRNWLEKAVA 320 R + K+GCPA A + SDTV + H GH +N + W +SR+ R W+++ V+ Sbjct: 125 RASIKIGCPASFTATQEVGSDTVVMVCRFQHQGHTVNTREYWANSRIPDNVREWIKERVS 184 Query: 321 SGIEWKDIKRMTRAEVERA 377 G + K+I +M + A Sbjct: 185 EGHDQKEIVQMIHEHQKNA 203